Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11100-AT1G61140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related
Function (paralog2):SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.1355335714175
Log2 mRNA fold difference:3.1718897396867
Log2 TE fold difference:-0.051515745390066
Sequences
Protein sequence

MSKKDSVFQSQADDFSGGFEFGADDEDFMIDIEAIYRILDESPVSMEVSQEIMSPVGSSV
VESGEFRNTLMQRSQATGWFPYRDLYGLGASQSEIAEPSSFSDPENGRLGLSATCYSDYG
GNVVSFPVNCEDGTVSILDDMRIESKFTPCSPTTMTTYLNNMPGNDSGIGATQNSSLMSH
FSPNSSSIVDCASSEPYGHHTMDAPLSEVSPNLVPGYAFQFFPKKEELLNDLKNEFIHCQ
SDGASRMVFDRHVGFDNGTSERNSGPDVSSERELSLKCEIIPSVSPVCVKPYNSSDGHQV
EKELEQPDNCSSSFQENRAVHMKVKPELALENTVYSSIPGNYSRCSDVHTVGGTTLPWSG
VSNCAISYQTDVGKEYPFIPPQTAFPGQDIDGRSFYSCFDSDDCFQNVTDPDPETSRTES
LDYLVGDEDHEYIKRTCFNLSSFSSGTVESLSSKRIPEREDDSEIHKIESYGEFVNPHQY
LPVQRPVFSSEHSTGSQTLNNCGGLKFESNKGNMNFHADLQDLSQHSSEASPPDGVLAVS
LLRHQRIALSWMSQKETSGNPCFGGILADDQGLGKTVSTIALILTERSTPYLPCEEDSKN
GGCNQSDHSQVVFNENKVVEDSLCKMRGRPAAGTLIVCPTSLMRQWADELRKKVTLEAHL
SVLVYHGCSRTKDPHELAKYDVVITTYSLVSVEVPKQPRDRADEEKGGIHDGGVESVGFG
SNKKDLPNSQKKGTKKRKHMDCEPVEFLSGPLAQVSWFRVVLDEAQSIKNYKTQASIACS
GLHAKRRWCLSGTPIQNSIADLYSYFRFLKYDPYSSYQTFCETIKNPISSYPGEGYKTLQ
AILKKVMLRRTKDTLLDGKPVISLPPKSIELRRVDFTKEERDFYSKLECDSRDQFKEYAE
AGTVKQNYVNILLMLLRLRQACGHPLLVSSLSWSSSAEMVKKLPYEKLTFLLHRLEASLA
ICGICNVAPKDAVVSLCGHVFCNQCICECLTRDNNQCPLSYCKVGLEISSLFSRETLENA
MLDLHKLDAPCDRTTSDPVGSGEPCENLPCGSSKIKAALDILQSLSRPQSPATVMNDVNQ
SSENGENNQQLDKSFSLPATPAKSSVGGVVNVAGEKAIVFTQWTKMLDLLEAGLKSSGIQ
YRRFDGKMTVPARDAAVQDFNTLPDVSVMIMSLKAASLGLNMVAACHVIMLDLWWNPTTE
DQAIDRAHRIGQTRPVKVVRFTVKDTVEDRILALQQKKRKMVASAFGEHENGSRESHLSV
EDLNYLFMA

MGEEGSMFGLGGEFPVDDCDGGFEFEDDDETIDIETLYRILDEKPDSAEGSQENLSPVGS
SADELKDSQLLNGSFDEHVKMEAGLSPSPAHTCSASLKDWFSLSQGEQPVETCGVSQSEM
TSCSISSSFSDPDGNMMAFNPVNCDVDTVSKQDDKIIDSKSMLTPYFDNVTGYGVGLGAN
HNSSAMSVFFNNSNSLSDSADNYVSSAQDCYNTSGTSLSDHTPNSVQNFAFEFFPNKEEA
VNDVESGVSESQSDGASRMIFDRHGRVDNGSLERKPPIDFSSARGISFKFESNPSVSPAC
VKPYNSFDSHLADSDLDRPNNYSCSFQDNKTVHVKVKPEAESEKVVYSSVPGEFSVRDDA
YLSGETNRWWSGASSSAVSYQTDIEKGYSYMAPQTALPSQDSGKISSNHFYDSDTCLQYV
VEDPSPVTQNNEYKDFQIQQGDREYIQPRGIDSQFSNASFESVQSHSSECISDSDDDSDV
CIIEPYGQSAIPHRPLAMKMPVVSSEYSTVSHNFNQSGGLKLQSNKENMIFQAALQDLTQ
PNSEAILPDGVLTVPLLRHQRIALSWMAQKETSGFPCSGGILADDQGLGKTVSTIALILK
ERSKPAQACEESTKKEIFDLESETGECAPLKPSGRSKHFEHSQLLSNENKVGGDSVGKVT
GRPAAGTLVVCPTSVMRQWADELHKKVTSEANLSVLVYHGSSRTKDPHELAKYDVVVTTF
SIVSMEVPKQPLVDDEDEEKDGVHDGGTAATGFCSNKKRKYPPDSKKKGSKKKKVEFLSG
PLAKVSWFRVVLDEAQSIKNYKTQVARACWGLRAKRRWCLSGTPIQNSIDDLYSYFRFLK
YDPYSSYVLFCSTIKNPITRNPVKGYQKLQAILKTVMLRRTKGSLLDGKPIISLPPKSIE
LRKVDFTVEERDFYSKLEAESRTQFREYAEAGTVKQNYVNILLMLLRLRQACDHPLLVNG
EYSFTWESSVGLAKKQIQSDASLAICGICNDAPEDAVASVCGHVFCKQCIYERLTGDSNH
CPFANCNVRLTISSLSSKTRLDDAMPDMQERATSNSLSPCSDEDLPYGSSKIKAALEILQ
SLPKAHDLTDSNQISENREYSGLSITPVKNEGMSVDVPIKVAGEKAIVFSQWTKMLNLLE
ASLVSSHIQYRRLDGTMSVAARDKAVQDFNTLPEVTVMIMSLKAASLGLNMVAACHVLML
DLWWNPTTEDQAIDRAHRIGQTRPVTVVRFTVKDTVEDRILALQQKKRMMVASAFGEDEK
GSRQSHLTVEDLSYLFMADS

Other information
Ka divergence:-0.292041KaKs divergence:0.268299
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):3810Length 2 (bp):3843Length divergence:0.004
MFE 1 (kcal):-1146.58MFE 2 (kcal):-1133.4MFE divergence-0.006