Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11160-AT1G61210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.406274994364
Log2 mRNA fold difference:2.1190833682646
Log2 TE fold difference:0.27338496562278
Sequences
Protein sequence

MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSPMSLCGHTSP
VDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSS
DTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLHEF
KCHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQT
LFCGLDDGLKVYSWEPVICRDGVDMGWSTLGDFCINEGKFIGCSYYRNSVGIWVSDISEL
EPYGAVSEDKNECMVKRFSVLNDQSERMGSGPRGSVSPDYETREIKNIYVDSTGGNLNVA
QNPGSLKATLPLESGKVATMVSEKQNAAYFGPAGDKYSSTSRDSDSGEESSYSERESIPF
SRTKSGMLLRPAHVRKTLAKFEESKQSAVVQSATRKKSGLAVEEEPQTQNAFLSEQNASK
PFDAEDSIIKGITNKFEKALSSEPPTDEANRMFLKPPRIHRSSNSKYNDTRRAMSADPAT
FGKGGMENSGDVEDIPSKTERVLSREKPGDEQKNTEYPSGSRELNPVKIVEGVNVVSGRT
RSLVEKFERGEKTTHTEGASTTIEQNNNAVQEDPRKTSRQTGETPVISTRRARSTPARVM
PIVLNRDSNVTSDEPPLTQPARTSSFPVMPVILNQASNVTYDEPSVALTQESRTSHARIL
PVTFNQATNITSEEASVTLRRQRRNSAARVRPVLLSQATSHECPVTSVRPLRTSPARVMP
TKLNQSVNMTSDTSHIASMHRVSPTQMLATPTVIDQVADMTLDETHATQIQPACDNMPQK
EEPNISDREDDSDITENLMLTHNEFLSTLQSRLTKLQIVRHFWERSDVKGAIGALRKLTD
QSVQADVISILTEKIEILTLDMFSQLVPVLTSLLGSRTERPVNVSLDMLLKLVAVFGTVI
RSTVSAPRIVGVDLHANERLEICQICSAGLHKIQRILPVLARRGGLITRKAQELNLVLQE
P

MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMSLCGHTSA
VDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHPFGEFLASGSS
DANLKIWDIRKKGCIQTYKGHSRGISTIRFTPDGRWVVSGGLDNVVKVWDLTAGKLLHEF
KFHEGPIRSLDFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRT
LFCGLDDSLKVYSWEPVVCHDGVDMGWSTLGDLCISEGKLLGCSYYQNSVGIWVSDISQI
EPYGIGSADKKECVEKILSALDDQSFDRIKSTPRRSSSPDYETKEIKNIYIDSTGGNSAV
AHKSGSLSTPATSTGQAGDNKSLVVHSVVPRDSDIGKDSSDSGKESITFSKTKPGMLLRP
AYVRKTPTKFDETKKQSVAVGYLKKSGLDGEKKLDTETAFDSEMSGRNPYDADDSIIKSI
TNKFEQALLPESPTDEAKCMLLKPPRVQRSPSTKYNEARWATSTDSGALDSKKNGLESSR
DMDLPTGLRDDRGSNPCEEDIENKSISSRSERVLSPEKAGDELKSLESPGGSKESKSVKV
VRGVKVVSGRTRSLVERFERGEKITHSEDKAASATVVHSSNSVEEEPLTASVQTVSMMPT
QVMPVKLDQATNSTTVDVPVLSTRRTKSTPVRVMPVVLGRDTSMATDTPPVTSTRPDRTS
ATNLTSDVSGVTSKRQTRTSPAPVMPMILNQTTKMKSDEPSITSTWPDRTSATDLTSDVS
GVISSRQTRTSPAPVMPMKLNQKTKIKSDEPPITSTRPDRPSATNLTSDESPVTSTRQAK
TSPAPVTPVILNQRQTTNMKSDEPPVISTRPLRTSSARVMPVILNQASTTYDERPLSSSR
SARTSPARIMPMKLNQADNMPSYEPPVALTRSARNSPARVIPVKLNQATNVTADASHIRS
RQRFSPTQTLATPAVFDQVTDMTLDETTKTQQSSDILTQKEEPQISGREDDGDIWEILMR
THSEVLNTLQSRLTKLQIVRHFWERSDIKGAIAALRKLSDHSVQADVINILTDKTEILTL
DLFSQLAPVLTGLLGSKTERPVNVSLEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERL
QICQSCSAELQKVQKILPLLTRRGGLIARKAQELNLVLQTP

Other information
Ka divergence:-0.112805KaKs divergence:-0.297262
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3066Length 2 (bp):3546Length divergence:0.073
MFE 1 (kcal):-926.75MFE 2 (kcal):-1057.04MFE divergence0.066