Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11180-AT1G61250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Secretory carrier membrane protein (SCAMP) family protein
Function (paralog2):secretory carrier 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.3612681283819
Log2 mRNA fold difference:1.7363092483136
Log2 TE fold difference:1.5802957888285
Sequences
Protein sequence

MGGRYDRNTFDEQDEVNPFANPGSVPAASNSRLSPLPPEPAGFGYGRTVDIPLDRPGSGA
QNNSCLNVTLLGIQDLKKKEKELQAKEADLRRREQDLKRKQDAAARAGIVIEAKNWPTFF
PLIHHDIANEILVRLQRLQYIAFATYLGLVLALFWNIIAVTTAWIKGEGVTIWLLAVIYF
ISGVPGGYVLWYRPLYRAFRSDSAFNFGWFFLFYMLHILFCLFAAVAPPIVFKGKSLAGI
LPAIDVLSAQALVGIFYFIGFGLFCLESVVSIWVIQQVYMYFRGSGKADDMRRDAARGAM
RAAI

MANRYDPNPFAEEEEVNPFANARGVPPASNSRLSPLPPEPVGFDYGRTVDIPLDRAGTQD
LKKKEKELQAKEAELKRREQDLKRKEDAAARAGIVIEVKNWPPFFPLIHHDIANEIPVHL
QRLQYVTFATYLGLVLCLFWNIIAVTTAWIKGEGVTIWLLALIYFIAGVPGGYVLWYRPL
YRAFRTDSALSFGWFFLFYMLHIAFCVFAAVAPPVVFKGKSLAGILPAIDVLSGQAIVGI
FYFIGFAFFCLESVVSIWVIQQVYMYFRGSGKQDQMRREAARGALRAAV

www.000webhost.com

Other information
Ka divergence:-0.0502397KaKs divergence:0.352526
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):915Length 2 (bp):870Length divergence:-0.025
MFE 1 (kcal):-263.14MFE 2 (kcal):-253.56MFE divergence-0.019