Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11210-AT1G61260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF761)
Function (paralog2):Protein of unknown function (DUF761)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3837423023393
Log2 mRNA fold difference:-1.5096060806602
Log2 TE fold difference:0.058082089966633
Sequences
Protein sequence

MASWMKAVLISTGVVATAMHLKVIVPVAMDFSQNPIILSSFLTWLKPPYLYVITNVIIIV
VGVSYRITTVSSHVDGKDYEASYSGDNKFQTDHQQIVQEAPLRRRTETKDADFGFIGKVL
QIVKEPEVVYEEKERPATVEEEEKKCIIVVSKSENQPPVEKPLVTARIGQKKPVVKTTPA
ERNSMRALRVAKPKRNETLENTWKMIMEGNKSTLPLTSYYKRPDTFGLGEETKQSGVLKK
SETFSDRTNCYQSLPPPPPPLVKVKKVKVSRSRDELNRKVEAFIKKCNDERFASMKLDNE
VARHGLSY

MVSWMMTTKAVLISSGVATVALLLKLSVPVAVDFSVSRAPILWSSLLSWLKPPYLYVVTN
GIIITIVASSKYYRSHHDRDEEDEIVVYGGGGYKIQTEEPIVNQHQASPRILEVKDLDTG
AHFGFVVANLEAEELESEAVTAVVFDDEEEEKKIIDSAATAEDEIEEELKSVIMVENSDL
VESDVIPPPMMIESENLPPIEKPLVTSRFGHRKLMKASQEGGRALRVTKPKKNETLENTW
KMITEGKSTPLTRQLYRRSDTFGRGDSGGVDGEVKPVYKKSDTFRDRTNYYQLAETAKVR
KEPSLSQEELNRRVEAFIKKFNEEMKLQRMESLRQYKEITSRGV

Other information
Ka divergence:-0.2769KaKs divergence:-0.340674
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):927Length 2 (bp):1035Length divergence:0.055
MFE 1 (kcal):-294MFE 2 (kcal):-348.83MFE divergence0.085