Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11280-AT1G61380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-locus lectin protein kinase family protein
Function (paralog2):S-domain-1 29

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.15103185545228
Log2 mRNA fold difference:-0.54667441527008
Log2 TE fold difference:0.43811540975915
Sequences
Protein sequence

MDLKENSFEHMGIHLGEIGIVLFPWFLWLSLFLSCGYAAITISSPLTLGQTLSSPGGFYE
LGFFSPNNSQNQYVGIWFKKITPRVVVWVANREKPITTPVANLTISRNGSLILLDSSKNV
VWSTRRPSISNKCHAKLLDTGNLVIVDDVSENLLWQSFENPGDTMLPYSSLMYNLATGEK
RVLSSWKSHTDPSPGDFVVRLTPQVPAQIVTMRGSSVYKRSGPWAKTGFTGVPLMDESYT
SPFSLSQDVGNGTGLFSYLQRSSELTRVIITSEGYLKTFRYNGTGWVLDFITPANLCDLY
GACGPFGLCVTSNPTKCKCMKGFVPKYKEEWKRGNMTSGCMRRTELSCQANLSTKTQGKG
VDVFYRLANVKPPDLYEYASFVDADQCHQGCLSNCSCSAFAYITGIGCLLWNHELIDTIR
YSVGGEFLSIRLASSELAGSRRTKIIVGSISLSIFVILAFGSYKYWRYRAKQNVGPTWAF
FNNSQDSWKNGLEPQEISGLTFFEMNTIRAATNNFNVSNKLGQGGFGPVYKGTLSDKKDI
AVKRLSSSSGQGTEEFMNEIKLISKLQHRNLVRLLGCCIDGEEKLLIYEFLVNKSLDTFL
FDLTLKLQIDWPKRFNIIQGVSRGLLYLHRDSCMRVIHRDLKVSNILLDDKMNPKISDFG
LARMFQGTQHQDNTRKVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIISGKKISSFC
CGEEGKTLLGHAWECWLETGGVDLLDEDISSSCSPVEVEVARCVQIGLLCIQQQAVDRPN
IAQVVTMMTSATDLPRPKQPLFALQIQDQESVVSVSKSVNHVTQTEIYGR

MGMVLFACLLLLIIFPTCGYAAINTSSPLSIRQTLSSPGGFYELGFFSPNNTQNQYVGIW
FKKIVPRVVVWVANRDTPVTSSAANLTISSNGSLILLDGKQDVIWSTGKAFTSNKCHAEL
LDTGNFVVIDDVSGNKLWQSFEHLGNTMLPQSSLMYDTSNGKKRVLTTWKSNSDPSPGEF
SLEITPQIPTQGLIRRGSVPYWRCGPWAKTRFSGISGIDASYVSPFSVVQDTAAGTGSFS
YSTLRNYNLSYVTLTPEGKMKILWDDGNNWKLHLSLPENPCDLYGRCGPYGLCVRSDPPK
CECLKGFVPKSDEEWGKGNWTSGCVRRTKLSCQAKSSMKTQGKDTDIFYRMTDVKTPDLH
QFASFLNAEQCYQGCLGNCSCTAFAYISGIGCLVWNGELADTVQFLSSGEFLFIRLASSE
LAGSSRRKIIVGTTVSLSIFLILVFAAIMLWRYRAKQNDAWKNGFERQDVSGVNFFEMHT
IRTATNNFSPSNKLGQGGFGPVYKGKLVDGKEIGVKRLASSSGQGTEEFMNEITLISKLQ
HRNLVRLLGYCIDGEEKLLIYEFMVNKSLDIFIFDPCLKFELDWPKRFNIIQGIARGLLY
LHRDSRLRVIHRDLKVSNILLDDRMNPKISDFGLARMFQGTQYQDNTRRVVGTLGYMSPE
YAWAGLFSEKSDIYSFGVLMLEIISGKRISRFIYGDESKGLLAYTWDSWCETGGSNLLDR
DLTDTCQAFEVARCVQIGLLCVQHEAVDRPNTLQVLSMLTSATDLPVPKQPIFAVHTLND
MPMLQANSQDFLSVNEMTESMIQGR

www.000webhost.com

Other information
Ka divergence:-0.0264983KaKs divergence:0.670976
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2493Length 2 (bp):2418Length divergence:-0.015
MFE 1 (kcal):-756.82MFE 2 (kcal):-711.79MFE divergence-0.031