Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11310-AT1G61560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Seven transmembrane MLO family protein
Function (paralog2):Seven transmembrane MLO family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.7912873709368
Log2 mRNA fold difference:-3.9693577861124
Log2 TE fold difference:0.26960065089356
Sequences
Protein sequence

MADQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKA
ELMLLGFISLLLTIGQTPISNICISQKVASTMHPCSAAEEAKKYGKKDAGKKDDGDGDKP
GRRLLLELAESYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVVYCIV
TYAFGKIKMRTWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTRVTLWIVC
FFRQFFGSVTKVDYLALRHGFIMAHFAPGNESRFDFRKYIQRSLEKDFKTVVEISPVIWF
VAVLFLLTNSYGLRSYLWLPFIPLVVILIVGTKLEVIITKLGLRIQEKGDVVRGAPVVQP
GDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNCFHESTADVVIRLVVGAV
VQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHHTAKNETKHGRHSGSNTPFS
SRPTTPTHGSSPIHLLHNFNNRSVENYPSSPSPRYSGHGHHEHQFWDPESQHQEAETSTH
HSLAHESSEPVLASVELPPIRTSKSLRDFSFKK

MADQVKEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKKKNKKALYEALEKVKA
ELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCSASEEARKYGKKDVPKEDEEENLRR
KLLQLVDSLIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCIVTYA
LGKTKMRRWKKWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSKSTITLWIVCFFR
QFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPVIWFIAV
LFLLTNTNGLNSYLWLPFIPFIVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQPGDH
FFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESRVDVIIRISIGLLVQI
LCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKNIKHGRTSESTTPFSSRP
TTPTHGSSPIHLLRNAPHKRSRSVDESFANSFSPRNSDFDSWDPESQHETAETSNSNHRS
RFGEEESEKKFVSSSVELPPGPGQIRTQHEISTISLRDFSFKR

www.000webhost.com

Other information
Ka divergence:-0.162561KaKs divergence:-0.0185248
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1722Length 2 (bp):1752Length divergence:0.009
MFE 1 (kcal):-484.84MFE 2 (kcal):-487.7MFE divergence0.003