Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11390-AT1G61640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.45676953663006
Log2 mRNA fold difference:-1.1006950828127
Log2 TE fold difference:0.45263771125404
Sequences
Protein sequence

MSRVLISKIVGKQTQSLVSNQKDRVSQWGSYRTAFTAALRSPQLRTYSSSGRIPSNVYCT
FAFRDLKGSFLSNHLSRSYTTAPARNVVSHHAQIAWRRLHYKYSERISTIAQAFSLSLTR
SHLLIPGIVAVTCGQVAWAQRAPGSGINHYASDKSLYTRAKNGPIFLSSLLFSVIEGFIL
IGRAFYIACLFTPTILMGLVVESCGPRFRKIWLEMVHRTLERAGPAFIKWGQWAATRPDL
FPKDLCSQLSKLHSNAPEHSFAYTKKTIEKAFGRKLSEIFEEFDEVPVASGSIAQVHRAS
LRFQYPGQKSKSSLVAVKVRHPGVGESIRRDFVIINLVAKISTLIPALKWLRLDESVQQF
GVFMLSQVDLAREASHLSRFIYNFRRWKDVSFPKPVYPLVHPAVLVETYEHGESVARYVD
GMEGHEWIKTRLAHIGTHALLKMLLVDNFIHADMHPGNILVRKKASRGGLFKTKKPHIVF
LDVGMTAELAKNDRENLLDFFKAVARRDGRTAAERTLKLSRKQNCPNPEAFIEEVEEAFK
FWGTPEGDLVHPADCMHELLEKVRRHRVNIDGNVCTVMVTTLVLEGWQRKLDPGYDVMHT
LQTMVLKTDWAKSLSYTVDGLMAP

MTLISRFLISRVISRTLFSNQNNRTAINVSVKLPQFRIQSNGYHTLGLLHNVKGRFLGSN
HHQLARRSYSIAVASNVVKQHAQVSWGRLVQRVTLSRSWNLPRISQIAQACSLSLARSHF
LLPGLLALTYRQVAYAQRVVPNPVVYSPSHISPYRSSINFPIVLSSLVFSAVKGVVLIGR
ALYLAILFSPNVIMALLGFACGPRYRQLQYEVLHRTLEKAGPAFIKFGQWIATRPDRFNK
DLCLQLSKLHSNAPEHSFAFTKKSIENAFGRKLSEIFEEFDEAPVASGSIAQVHRASLKF
QYAGQKVKSSEVAVKVRHPCVEETMKRDFVIINFVARLTTFIPGLNWLRLDECVQQFSVY
MLSQVDLSREASHLSRFIYNFRGWKDVSFPKPIYPLIHPAVLVETYEHGESVARYVDGSE
GQEKLKAKVAHIGTNALLKMLLVDNFIHADMHPGNILVRPNNTRRGLFRSRKPHIVFLDV
GMTAELSKTDRDNLLGFFKAVARRDGRTAAERTLKLSKQQNCPDPQAFIKEVEEAFTFWG
TEEGDLVHPADCMHELFEKMRSHRVNIDGNVSTVMFTTLVLEGWQRKLDPGYDVMRTLQT
MLLKTDWMKSLSYTIDGLMAP

Other information
Ka divergence:0.321999KaKs divergence:0.229441
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1875Length 2 (bp):1866Length divergence:-0.002
MFE 1 (kcal):-572.54MFE 2 (kcal):-554.93MFE divergence-0.016