Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11540-AT1G61740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sulfite exporter TauE/SafE family protein
Function (paralog2):Sulfite exporter TauE/SafE family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:5.1212258681796
Log2 mRNA fold difference:5.6834243878203
Log2 TE fold difference:-0.57328306421335
Sequences
Protein sequence

MTIIAGLEMKTASSFSAFMVTGVSFANVGCNLFLRNPKSRDKTLIDFDLALTIQPCLLLG
VSIGVICNRMFPNWLVLFLFAVFLAWSTMKTCKKGVSYWNLESERAKIKSPRDVDGIEVA
RSPLLSEEREDVRQRGMIRFPWMKLGVLVIIWLLFFSINLFRGNKYGQGIISIKPCGALY
WFLSSLQIPLTIFFTLCIYFSDNVQSNHTSHSNQNSEQETGVGGRQNKLMLPVMALLAGV
LGGLFGIGGGMLISPLLLQIGIAPEVTAATCSFMVLFSSSMSAIQYLLLGMEHAGTAAIF
ALVCFVASLVGLMVVKKVIAKYGRASIIVFAVGIVMALSTVLMTTHGAFNVWNDFVSGRY
MGFKLPC

MRNNFVPIILSFIIFLTPSIAEQEPSILSPVDQLLNKTSSYLDFSTKFNQPRIELTTSTI
IAGLLSFLASSISSAGGIGGGGLYVPIMTIVAGLDLKTASSFSAFMVTGGSIANVGCNLF
VRNPKSGGKTLIDFDLALLLEPCMLLGVSIGVICNLVFPNWLITSLFAVFLAWSTLKTFG
NGLYYWRLESEMVKIRESNRIEEDDEEDKIESLKLPLLEDYQRPKRFPWIKLGVLVIIWL
SYFAVYLLRGNKYGEGIISIEPCGNAYWLISSSQIPLTLFFTLWICFSDNVQSQQQSDYH
VSVKDVEDLRSNDGARSNKCMFPVMALLAGVLGGVFGIGGGMLISPLLLQVGIAPEVTAA
TCSFMVLFSSTMSAIQYLLLGMEHTGTASIFAVICFVASLVGLKVVQKVITEYGRASIIV
FSVGIVMALSIVLMTSYGALDVWNDYVSGRYMGFKLPC

www.000webhost.com

Other information
Ka divergence:-0.339196KaKs divergence:-0.0939016
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):1104Length 2 (bp):1377Length divergence:0.11
MFE 1 (kcal):-331.81MFE 2 (kcal):-404.18MFE divergence0.098