Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11560-AT1G61790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Oligosaccharyltransferase complex/magnesium transporter family protein
Function (paralog2):Oligosaccharyltransferase complex/magnesium transporter family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:6.1956272322202
Log2 mRNA fold difference:6.7561278548394
Log2 TE fold difference:-0.5381988195443
Sequences
Protein sequence

MVIQTNLSYRFFILIVFLFTLANPKSDSDLKNELVSLRSTAESGVISFNNDDVSKFITSV
STPRPYSLIIFFDAVHLHGNSQLRLPEFRREFRLVSATFITNNNNESNGTKLFFCEIEST
HSEASFRRFAVESLPHISLVSPTTENLTESDQMDGGDFTGLAESMAEFVERQTKLTVCSI
QRPPLISKTQIGIIVAIIIISTPILIKKILKGETLLHDHRIWLVGAVFVYFFSVSGTMHN
IIREMPMYIKDYEDSSKFVFFIEESEMQLGAEGFFVGFLYTVVGLLLAFVTNVVVRVKKL
DEQRMAMLLALSISFWAVRKVVYLDNWKTGYEIYPYWPSSWRG

MALKSKLVSLLFLIATLSSTFAASFSDSDSDSDLLNELVSLRSTSESGVIHLDDHGISKF
LTSASTPRPYSLLVFFDATQLHSKNELRLQELRREFGIVSASFLANNNGSEGTKLFFCEI
EFSKSQSSFQLFGVNALPHIRLVSPSISNLRDESGQMDQSDYSRLAESMAEFVEQRTKLK
VGPIQRPPLLSKPQIGIIVALIVIATPFIIKRVLKGETILHDTRLWLSGAIFIYFFSVAG
TMHNIIRKMPMFLQDRNDPNKLVFFYQGSGMQLGAEGFAVGFLYTVVGLLLAFVTNVLVR
VKNITAQRLIMLLALFISFWAVKKVVYLDNWKTGYGIHPYWPSSWR

www.000webhost.com

Other information
Ka divergence:-0.427865KaKs divergence:0.206541
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1032Length 2 (bp):1041Length divergence:0.004
MFE 1 (kcal):-260.21MFE 2 (kcal):-272.1MFE divergence0.022