Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11630-AT1G61870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):pentatricopeptide repeat 336

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.684174780592
Log2 mRNA fold difference:1.6524770403968
Log2 TE fold difference:1.0088014722927
Sequences
Protein sequence

MAFLFRIRTSEFILQKATQFRLKSSSSSIFTLKSLTSKQKKSRDTLSLLKSENNPDRILE
ICRSTSLSPDYHVDRIIFSVAVVTLAREKHFVAVSQLLDGFIQNQPDPKSESFAVRAIIL
YGRANMLDRSIQTFRNLEQYEIPRTVKSLNALLFACLMAKDYKEANRVYLEMPKMYGIEP
DLETYNRMIRVLCESGSTSSSYSIVAEMERKWIKPTAASFGLMIDGFYKEEKFDEVRKVM
RMMDEFGVHVGVATYNIMIQCLCKRKKSAEAKALIDGVMSCRMRPNSVTYSLLIHGFCSE
ENLDEAMNLFEVMVCNGYKPDSECYFTLIHCLCKGGDFETALILCRESMEKNWVPSFSVM
KWLVNGLASRSKVDEAKELIAVVKEKFTRNVDLWNEVEAALPLPQ

MALLSRIRSSTSLFRHLNASPQIRSLSSASTILSPDSKTPLTSKEKSKAALSLLKSEKDP
DRILEICRAASLTPDCRIDRIAFSAAVENLAEKKHFSAVSNLLDGFIENRPDLKSERFAA
HAIVLYAQANMLDHSLRVFRDLEKFEISRTVKSLNALLFACLVAKDYKEAKRVYIEMPKM
YGIEPDLETYNRMIKVFCESGSASSSYSIVAEMERKGIKPNSSSFGLMISGFYAEDKSDE
VGKVLAMMKDRGVNIGVSTYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIH
GFCNEDDFEEAKKLFKIMVNRGCKPDSECYFTLIYYLCKGGDFETALSLCKESMEKNWVP
SFSIMKSLVNGLAKDSKVEEAKELIGQVKEKFTRNVELWNEVEAALPQ

www.000webhost.com

Other information
Ka divergence:-0.42585KaKs divergence:-0.0667036
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1218Length 2 (bp):1227Length divergence:0.004
MFE 1 (kcal):-362.8MFE 2 (kcal):-349.1MFE divergence-0.019