Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11670-AT1G61890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.54556512720675
Log2 mRNA fold difference:-0.15736342810933
Log2 TE fold difference:-0.39089755308318
Sequences
Protein sequence

MGSEATTAVNNLQQPLLESTKSEADFRMESVLTDTHLSYFRRIYLASLIEMKYLFHLAAP
AIFVYVINNGMSMLTRIFAGRLGSMQLAAASLGNSGFNMFTLGLMLGMGSAVETLCGQAH
GAHRYDMLGVYLQRSTIVLVITGLPMTLLFIFSKPLLISLGEPADVASVASVFVYGMIPM
IFAYAVNFPIQKFLQSQSIVTPSAYISAATLVIHLILSWLSVFKFGWGLLGLSVVHSLSW
WIIVLAQIIYIKISPRCRRTWDGFSWKAFDGLWDFFQLSAASAVMLCLESWYSQILVLLA
GLLKDPELALDSLAICMSISAMSFMVSVGFNAAASVRVSNELGAGNPRSAAFSTAVTTGV
SFLLSLFEAIVILSWRHVISYIFTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGC
GWQAYVAYVNIGCYYIVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDW
DKEVEKASRRLDQWEDTSPLLKQ

MNSESLENLHRPLIESSKSFVDYRLETVLTDRELPYFRRIYLAMMIEMKFLFHLAAPAIF
VYVINNGMSILTRIFAGHVGSFELAAASLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAH
RYEMLGVYLQRSTVVLILTCLPMSFLFLFSNPILTALGEPEQVATLASVFVYGMIPVIFA
YAVNFPIQKFLQSQSIVTPSAYISAATLVIHLILSWIAVYRLGYGLLALSLIHSFSWWII
VVAQIVYIKMSPRCRRTWEGFSWKAFEGLWDFFRLSAASAVMLCLESWYSQILVLLAGLL
KNPELALDSLAICMSISAISFMVSVGFNAAASVRVSNELGAGNPRAAAFSTVVTTGVSFL
LSVFEAIVVLSWRHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQ
AFVAYVNIGCYYVVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKE
VEKASSRLDQWEESREPLLKQ

Other information
Ka divergence:0.0185998KaKs divergence:-0.999904
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1512Length 2 (bp):1506Length divergence:-0.002
MFE 1 (kcal):-465.46MFE 2 (kcal):-475.43MFE divergence0.011