Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11700-AT1G61930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF584
Function (paralog2):Protein of unknown function, DUF584

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9822974911947
Log2 mRNA fold difference:-2.1715275203293
Log2 TE fold difference:0.3070630127513
Sequences
Protein sequence

MARGRKLTMSQSERYLGSSYSYGDSNGNSATDESELTEEDIWSHAVDHSPEMLESHGAWN
TRDAVVRNGRVGGGLSLAFEDASSSPRIVHQIRGGGEGGGGGGGGGRVERQLASSAPVNV
PDWSKIYRVNSVESIHESDEEEEEDSGMMMPPHEYLAKSQQRRSRKSGGGGSVFEGVGRT
LKGRELRRVRDAIWSQTGFYG

MAKGRKPTTMNRSDRYLGSYTYGDSHGNSVTDELELGEEDIWSPAVIHDDTTENEESYGT
WNLRATLGKNGRVGGLSLAFEGSLVAPPSSSPMIVQKIHGGGGEGEEDRRKLASSAPVNV
PDWSKIYRVDSVESIHELDDEDDEDEESGMMPPHEYLAKSQARRSRKIGGGGASVFDGVG
RTLKGRELRRVRDAIWSQTGFYG

Other information
Ka divergence:-0.0136077KaKs divergence:-0.523959
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):606Length 2 (bp):612Length divergence:0.005
MFE 1 (kcal):-234.79MFE 2 (kcal):-228.82MFE divergence-0.013