Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11740-AT1G62050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ankyrin repeat family protein
Function (paralog2):Ankyrin repeat family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.7711204124337
Log2 mRNA fold difference:1.4948711315133
Log2 TE fold difference:0.30439021131705
Sequences
Protein sequence

MARSSPANIPATTIDDYAHSPVHYAVVVGDHAGLTRLVSSLPKLTDPEQIHTESDSMSQE
RVAEKISTVIDRRDVPFGETPLHLAVRLGDVFAAKTISSAGADITLQNAAGWNSLHEALC
RRNSEITEAILRDHHRSAWCKWRRRLPHLIAVLSRMRDFYMEISFHFESSVIPFVGKIAP
SDTYKIWKRGGDLRADTSLAGFDGFKIRRANQSFLFLSDGDEFLDVSPGTLLVLNRDDKT
ILNAFENAKDPISDSDIAGFCGQSSLYRPGMDVTKAKLVEITNWRRQAKIETVGEWKAKA
YDVENVSFSFKSRKVGKEQGLRLDETRRSVSEPLRPQRREQRRRSVSLPEAAILVANSSV
GRIKEKEIVKSLRPSVWLTDQFPLKTEELLPLLDILANHVKAVRRMRELLTTKFPAGTFP
VKLSIPVIPTVKVVMTFSKFVALPPLDEFYTPLSSPKHLLAAMEDQHDVHDDEKLDRRIS
SSRPSFSTPSWLRLNINATGKSSRRRLVDEEQVVDPFTIPTGYKWTSNSDNSVYILHIST
YLAHPKSVILSLVFTKKSSKNQRYIRYWDHYKMASEAPSWADQWGTGGIGVMAAEETTDG
KKDVTGKKSGKTKAGINKAKIVVFIGVNWMKNLVQRKKKDSTSS

MARPSSASATTAIRPEDYSHSPVHYAVVLGDHGALTRLLSSLPKLGDPEQIRTESDSLSQ
ERVADQISAVLDRRDVPSRETPLHLAVRLDDLFAARAISSAGGDISLQNASGWNPLQEAF
CRRNSEVMKVLLRHHHRLAWCKWRRRLPRLIAVLRRMRDFYMEISFHFESSVIPFVGKIA
PSDTYKIWKRDGNLRADTTLAGFDGLKIQRADQSFLFLGDGDESLDISPGSLLVLNRDDR
KILDAFESAGAPISDSDIAGFCSQSSLYRPGMDVTKAELVGRTNWRRQEKMENVGEWKAR
VYEIQKVTFSFRSRKIVTGDGSEQVLPLELDEDDEGFLVAENPSFLAPPPRSQRRHSSFV
KEDRDWISVGRKSVDVYPSAAPPPPRQSQSPRRSVSQFQPPRRSMAQVQPPRRSVAQAQP
PRRSVALPSTVSPVNPPPSPQIKEKEFVKSLHPSVWLTEQFPLKTEELLPLLDILANKVK
AVARMRDLLTTKFPPGTFPVKLSIPVVPTVKVVITFTKFVELPPAETFYTPLSSPRFLYS
ATAGEEDHSDGEKPDARNSISRPSTWLRLATGKGSHRRVEEEEQQTPDPFAIPIGYKWTS
MSSSNSKSGNSSKMKKSKSTKRTK

www.000webhost.com

Other information
Ka divergence:-0.390198KaKs divergence:0.173913
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1935Length 2 (bp):1875Length divergence:-0.016
MFE 1 (kcal):-649.77MFE 2 (kcal):-631.27MFE divergence-0.014