Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11910-AT1G62290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):aspartic proteinase A1
Function (paralog2):Saposin-like aspartyl protease family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.3509822192625
Log2 mRNA fold difference:-3.9142814272184
Log2 TE fold difference:-0.4378910280123
Sequences
Protein sequence

MKIYSRTVAVSLIVSFLLCFSAFAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRA
YRLGDSGDADVVVLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACL
LHPKYKSSRSSTYEKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGIT
FVVAKFDGILGLGFQEISVGKAAPVWYNMLKQGLIKEPVFSFWLNRNADEEEGGELVFGG
VDPNHFKGKHTYVPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTII
TMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGI
ESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGE
SAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWI
LGDVFMGKYHTVFDFGNEQVGFAEAA

MGVYSRAVAFSVFVSFLLFFTAYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRS
SLRSYNNNLGGDSGDADIVPLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKC
FFSLSCYFHAKYKSSRSSTYKKSGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIET
TSEPGLTFLVAKFDGLLGLGFQEIAVGNATPVWYNMLKQGLIKRPVFSFWLNRDPKSEEG
GEIVFGGVDPKHFRGEHTFVPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLL
AGPTAVVAMINKAIGASGVVSQQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAYDGT
HGVSMGIESVVDKENTRSSSGLRDAGCPACEMAVVWIQSQLRQNMTQERIVNYINEICER
MPSPNGESAVDCSQLSKMPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPP
PRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAV

www.000webhost.com

Other information
Ka divergence:0.236275KaKs divergence:0.00163239
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1521Length 2 (bp):1542Length divergence:0.007
MFE 1 (kcal):-495.7MFE 2 (kcal):-489.32MFE divergence-0.006