Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11950-AT1G62310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transcription factor jumonji (jmjC) domain-containing protein
Function (paralog2):transcription factor jumonji (jmjC) domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.96812223524503
Log2 mRNA fold difference:-0.583808436952
Log2 TE fold difference:-0.38146559831018
Sequences
Protein sequence

MEGEVATNGVILKHNGVKDISLETCWPEKKKPVEATSLSSGSSDIEEEISVECPKRVANQ
RRKRSKADEIKTKSSRKRKCDDENKCEENEKKQRSSVKKRATTWKEEEVVVDDEKKCEQQ
LQLVPSSKATSRSRSKKSVSVDTWLVNNEIDVSALSSRSESELSDSYLKTEYFNDCRSMT
RSLKANLGELAICHQCSKGERRYLFICTFCEVRLYCFPCIKKWYPHLSTDDILEKCPFCR
GTCNCCTCLHSSGLIETSKRKLDKYERFYHLRFLIVAMLPFLKKLCKAQDQEIETEAKVQ
DSMASQVDISESLCSNEERVFCNHCATSIVDLHRSCPKCSYELCLNCCQEIRGGWLSDRP
ECQLQFEYRGTRYIHGEAAEPSSSSVSEDETKTPSIKWNADENGSIRCAPKELGGCGDSV
LELKRILPVTWMSDLEQKAETFLASYSIKPPMSYCRCSSDMSSMKRKAASRDGSSDNYLY
SPDSLDVLKQEELLHFQEHWSKGEPVIVRNALNNTAGLSWEPMVMWRALCENVDSAISSN
MSDVKAIDCLANCEVKINTLCFFEGYSKGRTYENFWPEMLKLKDWPPSDKFENLLPRHCD
EFISALPFQEYSDPRSGILNIATKLPEGLLKPDLGPKTYVAYGTSDELGRGDSVTKLHCD
MSDAVNILMHTAEVTLSEEQRSAIADLKQKHKQQNEKELQEQNGLEEEEVVSDEIVVYDE
TSGALWDIFKREDVPKLEEYLRKHCIEFRHTYCSRVTKVYHPIHDQSYFLTVEHKRKLKA
EFGIEPWTFVQKLGEAVFIPAGCPHQVRNLKSCTKVAVDFVSPENIDECLRLTDEFRQLP
KNHKAREDKLEIKKMVIYAVEQALKEVETLLLDRS

MDSGVKLEHMNCFQLSYQYSWTTRKKRTLKPFMSKGSSPSSSSDSRKRKLSRAEDSDDSA
VKRNAKRRRKICKVEEYYEDDDCILSDWVQRNTAKRIDKRNEEVEVMVKIESGDDCTIGK
WFSDVSSKRKDKRQVEVDEDEEWEEEVTLCSKIKATSSRSRTHSLSANSPENVTDVISPC
RSRSPASNVSDSIQKNDCTSSRKQSGPICHQCLKGERITLLICSECEKTMFCLQCIRKWY
PNLSEDDVVEKCPLCRQNCNCSKCLHLNGLIETSKRELAKSERRHHLQYLITLMLPFLNK
LSIFQKLEIEFEATVQGKLPSEVEITAAISYTDERVYCDHCATSIVDLHRSCPKCSYELC
LKCCQEIREGSLSERPEMKFHYVDRGHRYMHGLDAAEPSLSSTFEDEEANPSDAKWSLGE
NGSITCAPEKLGGCGERMLELRRILPLTWMSDLEHKAETFLSSYNISPRMLNCRCSSLET
ELTRKSASRTTSSDNYLFCPESLGVLKEEELLHFQEHWAKGEPVIVRNALDNTPGLSWEP
MVMWRALCENVNSTSSSEMSQVKAIDCLANCEVEINTRQFFEGYSKGRTYENFWPEMLKL
KDWPPSDKFEDLLPRHCDEFISALPFQEYSDPRTGILNIATKLPEGFIKPDLGPKTYIAY
GIPDELGRGDSVTKLHCDMSDAVNILTHTAEVTLSQEQISSVKALKQKHKLQNKVDKQST
EDCNEKEEEEEEELNMPEISSNENEETGSALWDIFRREDVPKLEEYLRKHCKEFRHTYCS
PVTKVYHPIHDQSCYLTLEHKRKLKAEYGIEPWTFVQKLGEAVFIPAGCPHQVRNLKSCT
KVAVDFVSPENIHECLRLTEEFRQLPKNHKAREDKLEASLLSL

www.000webhost.com

Other information
Ka divergence:-0.0170019KaKs divergence:-0.0477398
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2628Length 2 (bp):2652Length divergence:0.005
MFE 1 (kcal):-761.18MFE 2 (kcal):-733.81MFE divergence-0.018