Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G11960-AT1G62320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ERD (early-responsive to dehydration stress) family protein
Function (paralog2):ERD (early-responsive to dehydration stress) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.99152199429893
Log2 mRNA fold difference:1.3361977914379
Log2 TE fold difference:-0.34808724715656
Sequences
Protein sequence

MATLGDIGVAAAINILTAIIFLLAFAILRIQPFNDRVYFPKWYLKGIRSSPLHSGALVSK
FVNVNLGSYLRFLNWMPAALKMPEPELIDHAGLDSAVYLRIYLIGLKIFVPIALLAWSIL
VPVNWTSHGLQLAKLRNVTSSDIDKLSISNIENGSDRFWTHLVMAYAFTFWTCYVLMKEY
EKVAAMRLAFLQNEQRRPDQFTVLVRNVPADPDESISDSVEHFFLVNHPDHYLTHQVVYN
ANDLAALVEQKKSTQNWLDYYQLKYTRNQEHKPRIKTGFLGLWGKKVDAIDHYIAEIEKL
NEQIMEERKKVKKDDTSVMPAAFVSFKTRWGAAVSAQTQQSSDPTEWLTEWAPEAREVFW
SNLAIPYVSLTVRRLIMHIAFFFLTFFFMIPIAFVQSLASIEGIEKNAPFLKSIIENDLF
KSVIQGFLPGIVLKLFLIFLPSILMVMSKFEGFVSLSSLERRAAFRYYIFNLINVFLGSV
ITGSAFEQLDSFLKQSAKEIPKTVGVAIPIKATFFITYIMVDGWAGIAGEILRLKPLIFF
HIKNSLLVKTEKDREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALA
YLVFRHQIINVYNQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFL
PIITFFFHRYCKGRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDND
YEDSRFDEISGYCIEDSDEECVTVPTKRQSRINTPAVSHASRGSSRSPPSK

MATLADIGLAAAINILSALIFLLLFAILRIQPFNDRVYFPKWYLKGVRSSPVNSGAFVSK
IMNLDFRSYVRFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLIGLKIFGPIALLSWSIL
VPVNWTSDGLQLAKLRNVTSSNIDKLSISNVERGSDRFWAHLVMAYAFTFWTCYVLMKEY
EKIAAMRLSFLQSEKRRADQFTVLVRNVPPDSDESISENVQHFFLVNHPDHYLTHQVVYN
ANELAKLVEDKKKMQNWLDYYQLKYTRNKEQRPRMGFLGLWGKKVDAMDHYTAEIEKLSE
QIMEERKRIKKDDKSVMQAAFVSFKTRWGAAVCAQTQQTKNPTEWLTEWAPEAREMYWPN
LAMPYVSLTVRRFVMHIAFFFLTFFFIIPIAFVQSLASIEGIEKSAPFLSPIVKNKLMKS
LIQGFLPGIVLKLFLIFLPTILMIMSKFEGFISISSLERRAAFRYYIFNLVNVFLGSVIT
GSAFEQLDSFLKQSANDIPRTVGVAIPIKATFFITYIMVDGWAGVAGEIFRLKPLVIFHL
KNFFFVKTEKDREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYL
VFRHQKYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFGFHR
FCKGRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDSDEEGLIE
DSDDEDCVVVQTKRQRSRRTTVASSNASRGSSQSTPFNQLDLGKGKPET

www.000webhost.com

Other information
Ka divergence:-0.0616424KaKs divergence:0.137079
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):2316Length 2 (bp):2310Length divergence:-0.001
MFE 1 (kcal):-672.51MFE 2 (kcal):-664.82MFE divergence-0.006