Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12040-AT1G62440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):leucine-rich repeat/extensin 1
Function (paralog2):leucine-rich repeat/extensin 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6452370703696
Log2 mRNA fold difference:-1.0198553973648
Log2 TE fold difference:-1.193379895152
Sequences
Protein sequence

MLFPPLRSLFLFTLLLSSVCFLQIKADHDDESDLGSDIKVDKRLKFENPKLRQAYIALQS
WKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELG
LLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRY
NEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQM
GKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANN
AFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASLLADIVVNGTMNCITGLARQRSDK
QCSSLLARPVDCSKFGCYNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVR
AYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYV
YSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPP
PVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP
SPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP
SPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPS
PTSYFPPMPSVSYDASPPPPPSYY

MESSDDCFIQLEVSVRLGVNDLLSFENYRTSFPWDSYSGLDGFFHLGAVDDEGNLTEIGQ
LMNLEIRGDDDDDDISDDNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNG
SDVCSYNGIFCAPSPSSPKTRVVAGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGE
VPLTFKHMKLLFELDLSNNRFVGKFPNVVLSLPSLKFLDLRYNEFEGSIPSKLFDKELDA
IFLNHNRFMFGIPENMGNSPVSALVLADNDLGGCIPGSIGLMGKTLNEIILSNDNLTGCL
PPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLEN
FTYSSNFFTGDAPRCVALLGDNVVVNGSMNCIDGKEDQRSSKECSSPASRSVDCSKFGCN
NFFSPPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSP
SFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP
PPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPY
YQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQS
PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPP
PSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPPKGCN
DSPSNDHHYQTPTPPSLPPPYYEDTPLPPIRGVSYASPPPPSIPYY

Other information
Ka divergence:-0.191763KaKs divergence:-0.286136
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):2235Length 2 (bp):2481Length divergence:0.052
MFE 1 (kcal):-468.36MFE 2 (kcal):-571.6MFE divergence0.099