Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12130-AT1G62540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Flavin-binding monooxygenase family protein
Function (paralog2):flavin-monooxygenase glucosinolate S-oxygenase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.7780357323134
Log2 mRNA fold difference:-0.27333226991005
Log2 TE fold difference:0.74123293518249
Sequences
Protein sequence

MTPPPNSISSRNVAVIGAGAAGLVAARELRREGHTVTIFERQKQVGGLWVCTPNVEPDLL
SIDPDRTVVHSSVYQSLRTNLPRECMGYSDFPFVTRPDDESRDPRRYPDHREVMRYLQDF
AKEFKIEEMIRFETEVFRVEPTAENSCKWRVQFRSSSGVSGEDIFDAVVICNGHFTEPRL
AHIPGIESWPGKQIHSHNYRVSDPFKGQVVIVIGYQSSGSDISRDIAILAKEVHIAAKSD
AYAKESSIYSNLHFHPTIDRVYEDGSVVFQDGKLIFADAIVHCTGYKYCFPFLETKGYVN
VEDNRVGPLYKHVFPPALAPGLSFIGLPSMALQFFMFEIQSRWVASVLSGRVKLPSEEQM
MEDVIAFYAKLKSLGIPKRFTHFLTDPQWTPMFEKLKPHEAVLISQSEYFNWIAEQCGCS
SIERWREEQYNIAIKKDDDNFRDEWDDDDQIIQEAYRDFAKFKPSKVWST

MAPAQNPISSQHVVVIGAGAAGLVAARELSREGHTVVVLEREKEVGGLWIYSPKAESDPL
SLDPTRSIVHSSVYESLRTNLPRECMGFTDFPFVPRFDDESRDSRRYPSHMEVLAYLQDF
AREFNLEEMVRFEIEVVRVEPVNGKWRVWSKTSGGVSHDEIFDAVVVCSGHYTEPNVAHI
PGIKSWPGKQIHSHNYRVPGPFENEVVVVIGNFASGADISRDIAKVAKEVHIASRASEFD
TYEKLPVPRNNLWIHSEIDTAYEDGSIVFKNGKVVYADSIVYCTGYKYRFTFLETNGYMN
IDENRVEHLYKHVFPPALSPGLSFVGLPSMGIQFVMFEIQSKWVAAVLSRRVTLPTEDKM
MEDISAWYASLDAVGIPKRYTHKLGKIQSEYLNWVAEECGCPLVEHWRNQQIVRGYQRLV
SHPETYRDEWDDNDLMEEAYEDFARKKLISFHPSHIL

www.000webhost.com

Other information
Ka divergence:-0.0469331KaKs divergence:-0.290468
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1413Length 2 (bp):1374Length divergence:-0.014
MFE 1 (kcal):-442.86MFE 2 (kcal):-430.86MFE divergence-0.014