Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12210-AT1G12220
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RPS5-like 1
Function (paralog2):Disease resistance protein (CC-NBS-LRR class) family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1465392321273
Log2 mRNA fold difference:2.4646653019536
Log2 TE fold difference:-1.1893813550825
Sequences
Protein sequence

MGGCVSVSLSCDREVNQFSQWLCVSGSYIQNLSENLASLQKAMGVLNAKRDDVQGRINRE
EFTGHRRRLAQVQVWLTRIQTIENQFNDLLSTCNAEIQRLCLCGFCSKNVKMSYLYGKRV
IVLLREVEGLSSQGVFDIVTEAAPIAEVEELPIQSTIVGQDSMLDKVWNCLMEDKVWIVG
LYGMGGVGKTTLLTQINNKFSKLGGGFDVVIWVVVSKNATVHKIQKSIGEKLGLVGKNWD
EKNKNQRALDIHNVLRRKKFVLLLDDIWEKVELKVIGVPYPSGENGCKVAFTTHSKEVCG
RMGVDNPMEISCLDTGNAWDLLKKKVGENTLGSHPDIPQLARKVSEKCCGLPLALNVIGE
TMSFKRTIQEWRHATEVLTSATDFSGMEDEILPILKYSYDSLNGEDAKSCFLYCSLFPED
FEIRKEMLIEYWICEGFIKEKQGREKAFNQGYDILGTLVRSSLLLEGAKDKDVVSMHDMV
REMALWIFSDLGKHKERCIVQAGIGLDELPEVENWRAVKRMSLMNNNFEKILGSPECVEL
ITLFLQNNYKLVDISMEFFRCMPSLAVLDLSENHSLSELPEEISELVSLQYLDLSGTYIE
RLPHGLHELRKLVHLKLERTRRLESISGISYLSSLRTLRLRDSKTTLDTGLMKELQLLEH
LELITTDISSGLVGELFCYPRVGRCIQHIYIRDHWERPEESVGVLVLPAIHNLCYISIWN
CWMWEIMIEKTPWKKNLTNPNFSNLSNVRIEGCDGLKDLTWLLFAPNLINLRVWGCKHLE
DIISKEKAASVLEKEILPFQKLECLNLYQLSELKSIYWNALPFQRLRCLDILNNCPKLRK
LPLDSKSVVKVEEFVIKYKEKKWIERVEWEDEATQYRFLPTCRLR

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETE
EFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRV
IMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILG
LYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWS
EKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCG
RMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGE
AMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPE
DYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDV
VREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAA
LTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIH
QLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEH
LEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCG
MREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKE
VEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRK
LPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPSSRWRWRET

Other information
Ka divergence:-0.0541788KaKs divergence:0.156348
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2658Length 2 (bp):2670Length divergence:0.002
MFE 1 (kcal):-780.43MFE 2 (kcal):-796.33MFE divergence0.01