Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12220-AT1G62630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Disease resistance protein (CC-NBS-LRR class) family
Function (paralog2):Disease resistance protein (CC-NBS-LRR class) family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.5099763024701
Log2 mRNA fold difference:2.3862344098968
Log2 TE fold difference:0.12646099627282
Sequences
Protein sequence

MGGCFSVSLPCDQVVSQFSQLLCVRGSYIHNLSKNLASLQKAMRMLKARQYDVIRRLETE
EFTGRQQRLSQVQVWLTSVLIIQNQFNDLLRSNEVELQRLCLCGFCSKDLKLSYRYGKRV
IMMLKEVESLSSQGFFDVVSEATPFADVDEIPFQPTIVGQEIMLEKAWNRLMEDGSGILG
LYGMGGVGKTTLLTKINNKFSKIDDRFDVVIWVVVSRSSTVRKIQRDIAEKVGLGGMEWS
EKNDNQIAVDIHNVLRRRKFVLLLDDIWEKVNLKAVGVPYPSKDNGCKVAFTTRSRDVCG
RMGVDDPMEVSCLQPEESWDLFQMKVGKNTLGSHPDIPGLARKVARKCRGLPLALNVIGE
AMACKRTVHEWCHAIDVLTSSAIDFSGMEDEILHVLKYSYDNLNGELMKSCFLYCSLFPE
DYLIDKEGLVDYWISEGFINEKEGRERNINQGYEIIGTLVRACLLLEEERNKSNVKMHDV
VREMALWISSDLGKQKEKCIVRAGVGLREVPKVKDWNTVRKISLMNNEIEEIFDSHECAA
LTTLFLQKNDVVKISAEFFRCMPHLVVLDLSENQSLNELPEEISELASLRYFNLSYTCIH
QLPVGLWTLKKLIHLNLEHMSSLGSILGISNLWNLRTLGLRDSRLLLDMSLVKELQLLEH
LEVITLDISSSLVAEPLLCSQRLVECIKEVDFKYLKEESVRVLTLPTMGNLRKLGIKRCG
MREIKIERTTSSSSRNKSPTTPCFSNLSRVFIAKCHGLKDLTWLLFAPNLTFLEVGFSKE
VEDIISEEKAEEHSATIVPFRKLETLHLFELRGLKRIYAKALHFPCLKVIHVEKCEKLRK
LPLDSKSGIAGEELVIYYGEREWIERVEWEDQATQLRFLPSSRWRWRET

MGISFSIPFDPCVNKVSQWLDMKGSYTHNLEKNLVALETTMEELKAKRDDLLRRLKREED
RGLQRLSEFQVWLNRVATVEDIIITLLRDRDVEIQRLCLCRFCSKNLTTSYRYGKSVFLR
LREVEKLKGEVFGVITEQASTSAFEERPLQPTIVGQKKMLDKAWKHLMEDGTGIMGMYGM
GGVGKTTLLTQLFNMFNKDKCGFDIGIWVVVSQEVNVEKIQDEIAQKLGLGGHEWTQRDI
SQKGVHLFNFLKNKKFVLFLDDLWDKVELANIGVPDPRTQKGCKLAFTSRSLNVCTSMGD
EEPMEVQCLEENVAFDLFQKKVGQKTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSC
KRTIQEWRNAIHVLNSYAAEFIGMEDKILPLLKYSYDNLKGEHVKSSLLYCALYPEDAKI
RKEDLIEHWICEEIIDGSEGIEKAEDKGYDIIGSLVRASLLMECVDLKGKSSVIMHDVVR
EMALWIASELGIQKEAFIVRAGVGVREIPKVKNWNVVRRMSLMGNKIHHLVGSYECMELT
TLLLGEGEYGSIWRWSEIKTISSEFFNCMPKLAVLDLSHNQSLFELPEEISNLVSLKYLN
LSHTGIRHLSKGIQELKKIIHLNLEHTSKLESIDGISSLHNLKVLKLYGSRLPWDLNTVK
ELETLEHLEILTTTIDPRAKQFLSSHRLMSRSRLLQIFGSNIFSPDRQLESLSVSTDKLR
EFEIMCCSISEIKMGGICNFLSLVDVTIYNCEGLRELTFLIFAPKLRSLSVVDAKDLEDI
INEEKACEGEDSGIVPFPELKYLNLDDLPKLKNIYRRPLPFLCLEKITIGECPNLRKLPL
DSRSGKQGENGCIIHYKDSRWLKGVKWADEATKKRFLPSCEHRLERCETIFED

www.000webhost.com

Other information
Ka divergence:0.0389907KaKs divergence:0.0855333
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):2670Length 2 (bp):2682Length divergence:0.002
MFE 1 (kcal):-796.33MFE 2 (kcal):-758.88MFE divergence-0.024