Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12240-AT1G62660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glycosyl hydrolases family 32 protein
Function (paralog2):Glycosyl hydrolases family 32 protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.77117900622694
Log2 mRNA fold difference:0.73369794828156
Log2 TE fold difference:3.343618880809E-5
Sequences
Protein sequence

MASSDALLPISAREEEPLCPYTRLPMADPNQETHGPRRRRPFKGLLAVSFGLLFIAFYVA
LIATHDGSRSNDEGIDETETITSRARLAGVSEKRNDGLWKLSGDRNTPAFEWNNSMLSWQ
RTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPI
AMVADQWYDSNGVWTGSATFLPDGSIVMLYTGSTDKAVQVQNLAYPEDPNDPLLLKWVKF
PGNPVLVPPPGILPKDFRDPTTAWKTSEGKWRITIGSKLNKTGISLVYDTIDFKTYEKLD
TLLHRVPNTGMWECVDFYPVSKTAGNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFD
SNGTWIPDDPTIDVGMTASLRYDYGKFYASKSFYDQNKGRRVLWSWIGESDSEASDVQKG
WSSLQGIPRTVVLDTKTGKNLVQWPVEEIKSLRLSSKQFDLEVGPGSVVPVDVGSAAQLD
IEAEFEINKESLDKIIGNASVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTP
VYFYVAKGKDSELKTFFCTDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEA
FGQGGRTCITSRVYPTTAIYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPYSDEAVRA
LSRT

MASTEALLPVTSLQDPLSESRSDQIPETRRRRPIKVHLAVYSGLLLIALYVTLIVTHDGS
KAEIATESRPRMAGVSEKSNDGVWISSDDGKVEAFPWNNTILSWQRTAFHFQPEKNWMND
PNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLYLPIAMVPDQWYDANGVWT
GSATFLDDGSIVMLYTGSTDEFVQVQNLAYPEDPSDPLLLKWVKFSGNPVLVPPPGIGAK
DFRDPTTAWKTSSGKWRITIGSKINRTGISLIYDTTDFKTYEKHETLLHQVPNTGMWECV
DFYPVSKTQLNGLDTSVNGPDVKHVIKASMDDTRIDHYAIGTYDDSNATWVPDNPSIDVG
ISTGLRYDYGKYYASKTFYDQNKGRRILWGWIGESDSEAADVQKGWSSVQGIPRTVVLDT
RTHKNLVQWPVEEIKSLRLSSKKFDMTIGPGTVVPVDVGSATQLDIEAEFEIKTDDLKLF
FDDDSVEADNKFSCETNGGSTARGALGPFGFSVLADEGLSEQTPVYFYVTKGKHSKLNTV
FCTDTSRSTLANDVVKPIYGSFVPVLKGEKLTMRILVDHSIVEGFAQGGRSCITSRVYPT
KAIYGATKLFLFNNAIDATVTASFTVWQMNNAFIHPYSSDDLGVPSST

www.000webhost.com

Other information
Ka divergence:0.0729074KaKs divergence:-0.0518807
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1995Length 2 (bp):1947Length divergence:-0.012
MFE 1 (kcal):-657MFE 2 (kcal):-604.86MFE divergence-0.041