Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12270-AT1G62740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):stress-inducible protein, putative
Function (paralog2):stress-inducible protein, putative

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.21742075829879
Log2 mRNA fold difference:0.55308511116139
Log2 TE fold difference:-0.33448449909607
Sequences
Protein sequence

MAEEAKAKGNAAFSSGDFTTAINHFTEAIALAPTNHVLFSNRSAAHASLHQYAEALSDAK
ETIKLKPYWPKGYSRLGAAHLGLNQFELAVTAYKKGLDVDPTNEALKSGLADAEASVARS
RAAPNPFGDAFQGPEMWTKLTSDPSTRGFLQQPDFVNMMQEIQKNPSSLNLYLKDQRVMQ
SLGVLLNVKFRPPPPQGDEAEVPESDMGQSSSNEPEVEKKREPEPEPEPEVTEEKEKKER
KEKAKKEKELGNAAYKKKDFETAIQHYSTAIEIDDEDISYLTNRAAVYLEMGKYNECIED
CNKAVERGRELRSDYKMVARALTRKGTALTKMAKCSKDYEPAIEAFQKALTEHRNPDTLK
RLNDAERAKKEWEQKQYFDPKLGDEEREKGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAY
SNRAASYTKLGAMPEGLKDAEKCIELDPTFSKGYSRKAAVQFFLKEYDNAMETYQAGLEH
DPSNQELLDGVKRCVQQINKANRGDLTPEELKERQAKGMQDPEIQNILTDPVMRQVLSDL
QENPSAAQKHMQNPMVMNKIQKLISAGIVQMK

MADEAKAKGNAAFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAHASLNHYDEALSDAK
KTVELKPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDPSNEGLKSGLADAKASASRS
RASAPNPFGDAFQGPEMWSKLTADPSTRGLLKQPDFVNMMKEIQRNPSNLNLYLQDQRVM
QALGVLLNIQIRTQQAGDDMEIGEEEMAVPSRKEPEVEKKRKPEPEPEPEPEFGEEKQKK
LKAQKEKELGNAAYKKKDFETAIQHYSTAMEIDDEDISYITNRAAVHLEMGKYDECIKDC
DKAVERGRELRSDYKMVAKALTRKGTALGKMAKVSKDYEPVIQTYQKALTEHRNPETLKR
LNEAERAKKELEQQEYYDPNIGDEEREKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYS
NRAACYTKLGAMPEGLKDAEKCIELDPTFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHD
PNNQELLDGVKRCVQQINKANRGDLTPEELKERQAKGMQDPEIQNILTDPVMRQVLSDLQ
ENPAAAQKHMQNPMIMNKIQKLISSGIVQMK

Other information
Ka divergence:0.100903KaKs divergence:0.104641
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1719Length 2 (bp):1716Length divergence:-0.001
MFE 1 (kcal):-513.58MFE 2 (kcal):-506.15MFE divergence-0.007