Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12310-AT1G62820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-binding EF-hand family protein
Function (paralog2):Calcium-binding EF-hand family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.157148486319
Log2 mRNA fold difference:-1.8311462975258
Log2 TE fold difference:0.82744262674661
Sequences
Protein sequence

MGKDGLSDDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSIIASENLS
SPFDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLEPNE
FDEWIKEVDVGSDGKIRYEDFIARMVAK

MSKDGLSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITTENLS
SPFDFNRFLDLMAKHLKTEPFDRQLRDAFKVLDKEGTGFVAVADLRHILTSIGEKLQPSE
FDEWIKEVDVGSDGKIRYEDFIARMVAK

Other information
Ka divergence:1KaKs divergence:0.99604
GC content 1 (%):51GC content 2 (%):45GC content divergence:-0.063
Length 1 (bp):447Length 2 (bp):447Length divergence:0
MFE 1 (kcal):-146.9MFE 2 (kcal):-135.6MFE divergence-0.04