Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12340-AT1G12390
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cornichon family protein
Function (paralog2):Cornichon family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.15924747695579
Log2 mRNA fold difference:0.10607228157518
Log2 TE fold difference:-0.066958260393562
Sequences
Protein sequence

MRGVTETDKLANGIFHLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLCVFYLLTGH
WFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNLFLTIFWMI
YSALDDYED

MGDIWTWLISFFFLIALVGIIVYQLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLC
VFYLLTGHWFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNL
FLTIFWMIYSALDDYED

Other information
Ka divergence:-0.649637KaKs divergence:-0.522649
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):390Length 2 (bp):414Length divergence:0.03
MFE 1 (kcal):-94.18MFE 2 (kcal):-93.43MFE divergence-0.004