Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12380-AT1G62870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.61889290256728
Log2 mRNA fold difference:-1.4876179666218
Log2 TE fold difference:0.76358550158184
Sequences
Protein sequence

MATTNAHTATQQTPPPPPPPPPAPAPPAMDGLTTDELTAKALNKRYEGLMTVRTKAVKGK
GAWYWTHLEPILVRNTDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNFNSVT
PISTITPSPTSSSSSPQTHHRKRNSSGAVTTAIPSRLNPPPIGGSYHVTPITVVDPSRFC
GGELHYSTPPPPQHLMLSGGKDDLGPLAMLEDSVKKLKSPKPSQTQSLTRSQIESALDSL
SDWVFESCGSVSLSGLEHPKFRAFLTQVGLPIISKRDFATTRLDLKHEEARAEAESRIRD
AMFFQISSDGWKPGESGESLVNLIVNLPNGTSLYRRAVLVNGAVPSNYAEEVLLETVKGI
CGNSPQRCVGIVSDKFKTKALRNLESQHQWMVNLSCQFQGLNSLIKDFVKELPLFKSVSQ
NCVRLAKFINNTAQIRNAHCKYQLQEHGESIMLRLPLHCYYDDERRSCSSSSSGSNKVCF
YEPLFNLLEDVLSSARAIQLVVHDDACKVVLMEDHMAREVREMVGDEGFWNEVEAVHALI
KLVKEMARRIEEEKLLVGQCLPLWDELRAKVKDWDSKFNVGEGHVEKVVERRFKKSYHPA
WAAAFILDPLYLIRDSSGKYLPPFKCLSPEQEKDVDKLITRLVSRDEAHIALMELMKWRT
EGLDPMYARAVQMKERDPVSGKMRIANPQSSRLVWETYLSEFRSLGKVAVRLIFLHATTG
GFKCNSSLLKWVNSNGRSHAAVDRAQKLIFISANSKFERRDFSNEEDRDAELLAMANGDD
HMLNDVLVDTSSV

MATTTNATTTATQQQTQTQSPTQQPSAEELATKALQKRYEGLMMVRTKAVKGKGAWYWSH
LEPILLHNTDTGFPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNFNSLPKPISTIS
PSPPPPPSSSHRKRNSSAVEALNHHHHHPHHHHQGSYNVTPLSVVDPSRFCGQFPVTQQP
HLMLSGGKDDLGPLAMLEDSVKKLKSPKTSQTRNLTKAQIDSALDSLSDWVFESCGSVSL
SGLEHPKLRAFLTQVGLPIISRRDFVTGRLDLKYEDSRAEAESRIHDAMFFQIASDGWKF
DSSGENLVNLIVNLPNGTSLYRRAVFVNGAVPSNYAEEVLWETVRGICGNSPQRCVGIVS
DRFMSKALRNLESQHQWMVNLSCQFQGFNSLIRDFVKELPLFKSVSQSCSRLVNFVNSTA
QIRNAVCKYQLQEQGETRMLHLPLDSSLFEPLYNLLEDVLSFARAIQLVMHDDVCKAVLM
EDHMAREVGEMVGDVGFWNEVEAVYLLLKLVKEMARRIEEERPLVGQCLPLWDELRSKIK
DWYAKFNVVEERQVEKIVERRFKKSYHPAWAAAFILDPLYLIKDSSGKYLPPFKCLSPEQ
EKDVDKLITRLVSRDEAHIAMMELMKWRTEGLDPVYARAVQMKERDPVSGKMRIANPQSS
RLVWETYLSEFRSLGRVAVRLIFLHATSCGFKCNSSVLRWVNSNGRSRAAVDRAQKLIFI
SANSKFERRDFSNEEERDAELLAMANGEDDVLNDVLIDTSSV

Other information
Ka divergence:0.0357074KaKs divergence:0.251857
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):2382Length 2 (bp):2289Length divergence:-0.02
MFE 1 (kcal):-757.56MFE 2 (kcal):-705.01MFE divergence-0.036