Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12390-AT1G62880
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cornichon family protein
Function (paralog2):Cornichon family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.022870715532637
Log2 mRNA fold difference:-1.0380066089118
Log2 TE fold difference:1.0126478865428
Sequences
Protein sequence

MGDIWTWLISFFFLIALVGIIVYQLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLC
VFYLLTGHWFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNL
FLTIFWMIYSALDDYED

MGEVWTWIISFLILITLLGLIVYQLISLADLEFDYINPYDSASRINFVVLPESILQGFLC
VFYLVTGHWFMALLCVPYLYYNFHLYSRKQHLIDVTEIFNLLDWEKKKRLFKLAYIILTL
FLTIFWLIYSTLDDYED

Other information
Ka divergence:0.602755KaKs divergence:0.495495
GC content 1 (%):42GC content 2 (%):38GC content divergence:-0.05
Length 1 (bp):414Length 2 (bp):414Length divergence:0
MFE 1 (kcal):-93.43MFE 2 (kcal):-88.75MFE divergence-0.026