Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12460-AT1G62950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):leucine-rich repeat transmembrane protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.2719073200494
Log2 mRNA fold difference:-1.9868981605798
Log2 TE fold difference:-0.51954940314274
Sequences
Protein sequence

MRKVHLFLVLVHFIYISTSRSDSISERDILLQFKGSISDDPYNSLASWVSDGDLCNSFNG
ITCNPQGFVDKIVLWNTSLAGTLAPGLSNLKFIRVLNLFGNRFTGNLPLDYFKLQTLWTI
NVSSNALSGPIPEFISELSSLRFLDLSKNGFTGEIPVSLFKFCDKTKFVSLAHNNIFGSI
PASIVNCNNLVGFDFSYNNLKGVLPPRICDIPVLEYISVRNNLLSGDVSEEIQKCQRLIL
VDLGSNLFHGLAPFAVLTFKNITYFNVSWNRFGGEIGEIVDCSESLEFLDASSNELTGRI
PTGVMGCKSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQV
LNLHNLNLIGEVPEDISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSI
PPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYNNLSGVIPPVPMIQAFGSS
AFSNNPFLCGDPLVTPCNSRGAAAKSRNSDALSISVIIVIIAAAVILFGVCIVLALNLRA
RKRRKDEEILTVETTPLASSIDSSGVIIGKLVLFSKNLPSKYEDWEAGTKALLDKENIIG
MGSIGSVYRASFEGGVSIAVKKLETLGRIRNQEEFEQEIGRLGGLQHPNLSSFQGYYFSS
TMQLILSEFVPNGSLYDNLHLRIFPGTSSSYGNTDLNWHRRFQIALGTAKALSFLHNDCK
PAILHLNVKSTNILLDERYEAKLSDYGLEKFLPVMDSFGLTKKFHNAVGYIAPELAQQSL
RASEKCDVYSYGVVLLELVTGRKPVESPSENQVLILRDYVRDLLETGSASDCFDRRLREF
EENELIQVMKLGLLCTSENPLKRPSMAEVVQVLESIRNGFGS

MQIGKLIWVIMFIFVHIIITSSRSFSDSIITEREILLQFKDNINDDPYNSLASWVSNADL
CNSFNGVSCNQEGFVEKIVLWNTSLAGTLTPALSGLTSLRVLTLFGNRITGNLPLDYLKL
QTLWKINVSSNALSGLVPEFIGDLPNLRFLDLSKNAFFGEIPNSLFKFCYKTKFVSLSHN
NLSGSIPESIVNCNNLIGFDFSYNGITGLLPRICDIPVLEFVSVRRNLLSGDVFEEISKC
KRLSHVDIGSNSFDGVASFEVIGFKNLTYFNVSGNRFRGEIGEIVDCSESLEFLDASSNE
LTGNVPSGITGCKSLKLLDLESNRLNGSVPVGMGKMEKLSVIRLGDNFIDGKLPLELGNL
EYLQVLNLHNLNLVGEIPEDLSNCRLLLELDVSGNGLEGEIPKNLLNLTNLEILDLHRNR
ISGNIPPNLGSLSRIQFLDLSENLLSGPIPSSLENLKRLTHFNVSYNNLSGIIPKIQASG
ASSFSNNPFLCGDPLETPCNALRTGSRSRKTKALSTSVIIVIIAAAAILVGICLVLVLNL
RARKRRKKREEEIVTFDTTTPTQASTESGNGGVTFGKLVLFSKSLPSKYEDWEAGTKALL
DKDNIIGIGSIGAVYRASFEGGVSIAVKKLETLGRIRNQEEFEQEIGRLGSLSHPNLASF
QGYYFSSTMQLILSEFVTNGSLYDNLHPRVSHRTSSSSSSHGNTELNWHRRFQIAVGTAK
ALSFLHNDCKPAILHLNVKSTNILLDERYEAKLSDYGLEKFLPVLNSSGLTKFHNAVGYI
APELAQSLRVSDKCDVYSYGVVLLELVTGRKPVESPSENEVVILRDHVRNLLETGSASDC
FDRRLRGFEENELIQVMKLGLICTTENPLKRPSIAEVVQVLELIRNGMES

Other information
Ka divergence:0.168033KaKs divergence:-0.371788
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):2649Length 2 (bp):2673Length divergence:0.005
MFE 1 (kcal):-792.64MFE 2 (kcal):-778.72MFE divergence-0.009