Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12560-AT1G62980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):expansin A7
Function (paralog2):expansin A18

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.34029944441424
Log2 mRNA fold difference:0.36979187394597
Log2 TE fold difference:-0.71611428332277
Sequences
Protein sequence

MGPISSSWSFNKFFSIVFVVFAISGEFVAGYYRPGPWRYAHATFYGDETGGETMGGACGY
GNLFNSGYGLSTAALSTTLFNDGYGCGQCFQITCSKSPHCYSGKSTVVTATNLCPPNWYQ
DSNAGGWCNPPRTHFDMAKPAFMKLAYWRAGIIPVAYRRVPCQRSGGMRFQFQGNSYWLL
IFVMNVGGAGDIKSMAVKGSRTNWISMSHNWGASYQAFSSLYGQSLSFRVTSYTTGETIY
AWNVAPANWSGGKTYKSTANFR

MDQNLYRKCLVILSMMAMIGTSMATYAGTPWRTASATFYGDDTGSATMGGACGYGNMYDS
GYGVATTALSTALFNEGYACGQCFQLKCVSSPNCYYGSPATVVTATNICPPNYGQASNNG
GWCNPPRVHFDLTKPAFMKIANWKAGIIPVSYRRVACKKIGGIRFKFEGNGYWLLVYVMN
VGGPGDIKTMAVKGSRTGWINMSHNWGASYQAFSSLYGQSLSFRLTSYTTRQTIYAYNAA
PASWSAGKTYQSKANFN

www.000webhost.com

Other information
Ka divergence:0.272679KaKs divergence:-0.43601
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):789Length 2 (bp):774Length divergence:-0.01
MFE 1 (kcal):-253.7MFE 2 (kcal):-265.3MFE divergence0.022