Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12610-AT1G63030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.45392704459391
Log2 mRNA fold difference:0.94517483839712
Log2 TE fold difference:-1.2894896764995
Sequences
Protein sequence

MNNDDIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYP
TADMAARAHDVAVLALRGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLE
SGITVLPCAGDDVDLGFGSGSGSGSGSEERNSSSYGFGDYEEVSTTMMRLAEGPLMSPPR
SYMEDMTPTNVYTEEEMCYEDMSLWSYRY

MENDDITVAEMKPKKRAGRRIFKETRHPIYRGVRRRDGDKWVCEVREPIHQRRVWLGTYP
TADMAARAHDVAVLALRGRSACLNFSDSAWRLPVPASTDPDTIRRTAAEAAEMFRPPEFS
TGITVLPSASEFDTSDEGVAGMMMRLAEEPLMSPPRSYIDMNTSVYVDEEMCYEDLSLWS
Y

Other information
Ka divergence:-0.115613KaKs divergence:-0.0524771
GC content 1 (%):50GC content 2 (%):54GC content divergence:0.038
Length 1 (bp):630Length 2 (bp):546Length divergence:-0.071
MFE 1 (kcal):-218.6MFE 2 (kcal):-200.3MFE divergence-0.044