Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12640-AT1G63050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MBOAT (membrane bound O-acyl transferase) family protein
Function (paralog2):MBOAT (membrane bound O-acyl transferase) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2326570548981
Log2 mRNA fold difference:-1.681515562161
Log2 TE fold difference:0.4301796064237
Sequences
Protein sequence

MDMSSMAGSIGVSVAVLRFLLCFVATIPVSFACRIVPSRLGKHLYAAASGAFLSYLSFGF
SSNLHFLVPMTIGYASMAIYRPKCGIITFFLGFAYLIGCHVFYMSGDAWKEGGIDSTGAL
MVLTLKVISCSMNYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPVYEM
KDYLEWTEGKGIWDTTEKRKKPSPYGATIRAILQAAICMALYLYLVPQYPLTRFTEPVYQ
EWGFLRKFSYQYMAGFTARWKYYFIWSISEASIIISGLGFSGWTDDASPKPKWDRAKNVD
ILGVELAKSAVQIPLVWNIQVSTWLRHYVYERLVQNGKKAGFFQLLATQTVSAVWHGLYP
GYMMFFVQSALMIAGSRVIYRWQQAISPKMAMLRNIMVFINFLYTVLVLNYSAVGFMVLS
LHETLTAYGSVYYIGTIIPVGLILLSYVVPAKPSRPKPRKEE

MELLDMNSMAASIGVSVAVLRFLLCFVATIPISFLWRFIPSRLGKHIYSAASGAFLSYLS
FGFSSNLHFLVPMTIGYASMAIYRPLSGFITFFLGFAYLIGCHVFYMSGDAWKEGGIDST
GALMVLTLKVISCSINYNDGMLKEEGLREAQKKNRLIQMPSLIEYFGYCLCCGSHFAGPV
FEMKDYLEWTEEKGIWAVSEKGKRPSPYGAMIRAVFQAAICMALYLYLVPQFPLTRFTEP
VYQEWGFLKRFGYQYMAGFTARWKYYFIWSISEASIIISGLGFSGWTDETQTKAKWDRAK
NVDILGVELAKSAVQIPLFWNIQVSTWLRHYVYERIVKPGKKAGFFQLLATQTVSAVWHG
LYPGYIIFFVQSALMIDGSKAIYRWQQAIPPKMAMLRNVLVLINFLYTVVVLNYSSVGFM
VLSLHETLVAFKSVYYIGTVIPIAVLLLSYLVPVKPVRPKTRKEE

Other information
Ka divergence:0.30814KaKs divergence:0.0415364
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1389Length 2 (bp):1398Length divergence:0.003
MFE 1 (kcal):-418.69MFE 2 (kcal):-412.2MFE divergence-0.008