Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12710-AT1G63090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phloem protein 2-A12
Function (paralog2):phloem protein 2-A11

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.55730001953826
Log2 mRNA fold difference:1.1037861808222
Log2 TE fold difference:-0.90389976754157
Sequences
Protein sequence

MGVAHSDLHNDLSSSSCFGDRNILKPGLGDLPEACVAIIVENLDPVEICRFSKLNRAFRG
ASWADCVWESKLPQNYRDVLEKILGGFPENLQKRHLYAFLSRINSFDDATKKVWIDKRTS
GVCLSISAKGLSITGIDDRRYWSHIPTDESRFSSVAYLQQIWWFEVDGEIDFPFPVGTYS
IFFRLQLGRSGKWFGRRVCNTEQVHGWDIKPVRFQLWTEDGQYSSSQCMLTERGNWIHYH
AGDVVVRESNRSSTKIKFSMTQIDCTHTKGGLSLDSVVVYPSSCKDQLKRF

MGSGFSLFQKNLSSCYGDRDLLQPGLGDLPESCVALILQNLDPVEICRFSKLNTAFHGAS
WADFVWESKLPPDYKLILEKILGSFPDNLRKRDIFTFLSRVNSFDEGNKKAWVDKRTGGL
CLCTSAKGLSITGIDDRRYWSHIPSDDSRFASVAYVQQIWWFQVDGEIDFPFPAGTYSVY
FRLQLGKPGKRFGWKVVDTEQVHGWNIKPVRFQLSTEDGQHSSSQCMLTEAGNWSHYHAG
DFVVGKSKSSSTKIKFSMTQIDCTHTKGGLCVDSVVVYPSSCKDRLMQI

www.000webhost.com

Other information
Ka divergence:0.241818KaKs divergence:0.14368
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):876Length 2 (bp):870Length divergence:-0.003
MFE 1 (kcal):-274.69MFE 2 (kcal):-264.46MFE divergence-0.019