Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12730-AT1G63110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GPI transamidase subunit PIG-U
Function (paralog2):GPI transamidase subunit PIG-U

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.7537229681784
Log2 mRNA fold difference:3.1902854478521
Log2 TE fold difference:-0.4499975026485
Sequences
Protein sequence

MKEEKKDDGVMAEEKPYMFWIWTLASTIFRLFLIFSPANINLSSRPEVSTPHTSLRRLAE
GYWLKQSSLSPYAGSMYHGSPLLLSILGPLTVQRIEGQSSHHLCSLVFVIADLLSALLLR
AIGQKLQKSYRMNLRPLGVLRSSQDRGILPCGDIAALVYLWNPFTILSCVGLSTSPIENL
AVIVSLYGAVTRRVPLAAFGLIMATHLSLYSAPLVFPLIFLLGYGLDAPPIKKFLQTRHG
GVETGSTSDVSKQEKLTPTTQLPFSWRTVLHFVFWVLVWSSYVLVLCSLSLKQYGGLEEM
FKRTYGFILRIEDLSPNIGVFWYFFAEAFEFSRNYLLIIFNLYILLTSIPSLMFRLKHRP
CFLAFAYLAFTSILKSYPSVGDAALYLSLWALFVNELTDMEYSFFIFCGYIGFSLLSPVM
HNFWIWRGTGNANFYFGNAMGYACFQFMFVEKSVNAMLNHDQALKKATAEMTKN

MAEEQKMKQLSRFWIWALSSIAFRLILISFPGNLNLSSRPEVSTPLTSIRRLAEGYWLKQ
ASMSPYAGSMYHGSPLLLSVLGPLTVQRIKGQPSHLLCSLVFVIADILSAMLLRAIGQKL
QMAYGLNARLLGFLKSSRDKVILPCGDIAALVYLWNPFTIVSCVGLSTSPIENLAVILAL
FGAVTRRVPLAAFGLVIATHLSLYPATLTIPIIFLLGYGLDAPPIKLFLQTRSVENEESS
TSTVSKQAKLKQTTHLPFLWKTVAHFLFWVLLWSLYVLILCALSLNKYGGLEEMFKRTYG
FILSIEDLSPNIGVFWYFFAEVFDFFRNFFLIVLHVNILFMLLPLAIRLKHRPCFLAFIY
LAISSILKSYPSVGDSALYLSLWALFVNELLDMKFSFFLFCGYLGISLLSPVMHNLWIWR
GTGNANFYFGNAIGYACFQIVFVVESVSAMLNHDRALKRSNSNHREVKS

www.000webhost.com

Other information
Ka divergence:-0.127154KaKs divergence:-0.202469
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1425Length 2 (bp):1410Length divergence:-0.005
MFE 1 (kcal):-403.53MFE 2 (kcal):-411.64MFE divergence0.01