Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12750-AT1G63120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RHOMBOID-like protein 6
Function (paralog2):RHOMBOID-like 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.41545829410198
Log2 mRNA fold difference:0.039525679874919
Log2 TE fold difference:-0.20902533101606
Sequences
Protein sequence

MRSRDMERGRKHRGDTQWTAWLTPTIVVANVSIFIVVMYTNDCPKTTTGANGDCVAKLLR
RFSFQPLRENPFLGPSSSTLEKLGALDWKKVVQGNEKWRLITAMWLHAGIIHLVMNMFDV
IIFGIRLEQQFGFIRIGLIYLISGFGGSILSALFLQKSISVGASGALLGLMGAMLSELLT
NWTIYKSKLCALLSFLFIIAINLAIGLLPWVDNFAHIGGLLTGFCLGFILLMQPQSGWEE
FRNSSQYGARARSKYNPCQYVLFFVAAVLVVAGLTVGLVMLFDGENGNKHCKWCHRLDCY
PTSKWSC

MANRDVERVGKKNRGANNNYFYEESSGETHWTSWLIPAIVVANLAVFIAVMFVNDCPKKI
TGPNKECVARFLGRFSFQPLKENPLFGPSSSTLEKMGALEWRKVVHEHQGWRLLSCMWLH
AGIIHLLTNMLSLIFIGIRLEQQFGFIRVGLIYLISGLGGSILSSLFLQESISVGASGAL
FGLLGAMLSELLTNWTIYANKAAALITLLFIIAINLALGMLPRVDNFAHIGGFLTGFCLG
FVLLVRPQYGWEASRTNTSRTKRKYSMYQYVLFVVSVVLLVVGLTVALVMLFKGENGNKH
CKWCHYLSCFPTSKWTC

www.000webhost.com

Other information
Ka divergence:-0.432829KaKs divergence:-0.815301
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):924Length 2 (bp):954Length divergence:0.016
MFE 1 (kcal):-317.01MFE 2 (kcal):-303.8MFE divergence-0.021