Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12760-AT1G63170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc finger, C3HC4 type (RING finger) family protein
Function (paralog2):Zinc finger, C3HC4 type (RING finger) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.86022331171472
Log2 mRNA fold difference:-0.95311078213013
Log2 TE fold difference:0.14139793557533
Sequences
Protein sequence

MSTETTTGNSSLIPASSSSSSSDAIDPAPLLFNGDDNEGNNGGGGGERRSVRRQGLREAA
RFLSRASSGRVMREPSMLVREAAAEQLEERQSDWAYSKPVVVLDIVWNLAFVSVATAILV
MSRKEHPIMPLRVWLLGYALQCVLHMVCVCVEYRRRNRRRTNRTTTTTPPRSRSSSSSSS
SSSLEEEALGSRRNSGVQDLSLGHLDTESSSVAKHLESANTMFSFIWWIIGFYWVSAGGQ
ELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVLYAVADQEGASK
EDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECCICLSAY
EDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILKSSNLDREEV

MSRETTTEATPLILTDGGGGRRSVRRQGLREAARLLRHASSGRMMMREPSMLVREAAAEQ
LEERQSDWAYSKPVVVLDFVWNLAFVVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHM
VCVCVEYRRRNSRRRRDLSPRSSSSSSSSSSSMDEEEGLGLSRNSDERYLELGQLENENN
SFAKHLESANTMISFIWWVIGFYWVSSGGQELAQGSPQLYWLCIVFLGFDVFFVVFCVAL
ACVIGIAVCCCLPCIIAVLYAVAEQEGASKEDIDQLTKFKFRKVGDTMKHTVDEEQGQGD
SGGVMTECGTDSPVEHALPHEDAECCICLSAYEDETELRELPCGHHFHCGCVDKWLYINA
TCPLCKYNILKSSNYEEGEEV

Other information
Ka divergence:0.102108KaKs divergence:-0.131008
GC content 1 (%):47GC content 2 (%):43GC content divergence:-0.044
Length 1 (bp):1227Length 2 (bp):1146Length divergence:-0.034
MFE 1 (kcal):-416.7MFE 2 (kcal):-355.7MFE divergence-0.079