Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G12780-AT1G63180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-D-glucose/UDP-D-galactose 4-epimerase 1
Function (paralog2):UDP-D-glucose/UDP-D-galactose 4-epimerase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.3350577552235
Log2 mRNA fold difference:-2.2357405271767
Log2 TE fold difference:-0.11445561186001
Sequences
Protein sequence

MGSSVEQNILVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNSVIEAVDRVRELVGPDLSK
KLDFNLGDLRNKGDIEKLFSKQRFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYET
MAKYNCKMMVFSSSATVYGQPEKIPCMEDFELKAMNPYGRTKLFLEEIARDIQKAEPEWR
IILLRYFNPVGAHESGSIGEDPKGIPNNLMPYIQQVAVGRLPELNVYGHDYPTEDGSAVR
DYIHVMDLADGHIAALRKLFADPKIGCTAYNLGTGQGTSVLEMVAAFEKASGKKIPIKLC
PRRSGDATAVYASTEKAEKELGWKAKYGVDEMCRDQWKWANNNPWGYQNKL

MGSSVEQNILVTGGAGFIGTHTVVQLLNQGFKVTIIDNLDNSVVEAVHRVRELVGPDLST
KLEFNLGDLRNKGDIEKLFSNQRFDAVIHFAGLKAVGESVGNPRRYFDNNLVGTINLYET
MAKYNCKMMVFSSSATVYGQPEIVPCVEDFELQAMNPYGRTKLFLEEIARDIHAAEPEWK
IILLRYFNPVGAHESGRIGEDPKGIPNNLMPYIQQVAVGRLPELNVFGHDYPTMDGSAVR
DYIHVMDLADGHVAALNKLFSDSKIGCTAYNLGTGQGTSVLEMVSSFEKASGKKIPIKLC
PRRAGDATAVYASTQKAEKELGWKAKYGVDEMCRDQWNWANKNPWGFQKKP

www.000webhost.com

Other information
Ka divergence:0.499096KaKs divergence:-0.113417
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1056Length 2 (bp):1056Length divergence:0
MFE 1 (kcal):-318.82MFE 2 (kcal):-311.3MFE divergence-0.012