Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13080-AT1G13090
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 71, subfamily B, polypeptide 2
Function (paralog2):cytochrome P450, family 71, subfamily B, polypeptide 28

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.2126347275433
Log2 mRNA fold difference:-3.2434810587418
Log2 TE fold difference:0.012492836085245
Sequences
Protein sequence

MTILLCFFLVSLLTIVSSIFLKQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSI
KYGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYG
EYWREVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKVSESALKQSPVDLSKTFFSLTAS
IICRVALGQNFNESGFVIDQDRIEELVTESAEALGTFTFSDFFPGGLGRFVDWLFQRHKK
INKVFKELDAFYQHVIDDHLKPEGRKNQDIVTLILDMIDKQEDSDSFKLNMDNLKAIVMD
VFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERITEEDLGKVEYLNHIL
KETFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWNDPEEFNPERF
ANSSVDFRGQHFDLLPFGSGRRICPGMPMAIASVELALMNLLYYFDWSMPDGTKGEDIDM
EEAGNISIVKKIPLQLVPVQRY

MSVFLCFLCLLPLILIFLKNLKPSKWKLPPGPKKLPIIGNLHQRRELHPRNSRNLSEKYG
PIVFLRYGFVPVVVISSKEAAEEVLKTHDLECCSRPETVGTRAISYNFKDIGFAPYGEDW
RTMRKLSVVELFSSKKLQSFRYIREEENDLCVKKLSDLASRRSLVNLEKTLFTLVGSIVC
RIGFGINLRECEFVDEDSIDDLVHKSEDVIRNSIFSDFFPGLMGRLIEWIFSERKRLNRL
YSEVDTFFQNILDDHLKPGRESSDIIDVMIDMMKKQEKEGDSFKFTTDHLKGMISDIFLA
GVGTSSTTLIWAMTELIRNPRVMKKVQDEIRTTLGDKKERITEEDLNQLHYFKLMVKEIF
RLHPAAPLLLPRETLSHVKIQGYDIPAKTQIMINAYAIARDPKLWTNPDEFNPDRFLDSS
IDYRGLNFELLPFGSGRRICPGMTMGIAIVELGLLNLLYFFDWGLPEKEEAKEIITGNEV
ALDLVQVFLH

www.000webhost.com

Other information
Ka divergence:0.0735889KaKs divergence:-0.146574
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1509Length 2 (bp):1473Length divergence:-0.012
MFE 1 (kcal):-419MFE 2 (kcal):-458.88MFE divergence0.045