Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13470-AT1G13480
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function (DUF1262)
Function (paralog2):Protein of unknown function (DUF1262)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.84124235662708
Log2 mRNA fold difference:0.59206226347076
Log2 TE fold difference:0.33529456718085
Sequences
Protein sequence

MYVTRRLSEYQRNRSELPESPNSGVLIIQDEESRPTCCFGSCYRATLKGLPFPQNANLIV
SESRIFLNQTITYIDPVVFIPVLDQPLSSNRYYVIKRGGKHSGKASANAKEEDRVPCCFC
FSYVPEAKPQEADPNDIYQQFQIHQKRSSSRYYTATSVAPNGKPPEFLKRKYWNAEYSTS
EDFGLKDDAKGIYTEIRSELPSDFNTSVVVGKWYVPFIFVKEGNAKDQLKSSAYYSMILL
QRWEEVYSCENAYNENREVVVDVEVEPEVVKLEGQEIGKNTKRVDENGVFWFAVAEKRIG
LRSVVMERMKWEEERFGWKIEPQRAVVKKSERFNGGGSNWKSYRCYVLVESFELRRKDKS
LVLTFEFKHVDKLRTKWES

MYVTRRLSEYQKKPSELKLLPPEGPNSGIMVIQDEESQATCCFGSCYEGRLKGLPFPQNV
KLNAAYTSGGGEHQTTHLTPVVFIPVLDQPLSSNLYYVLQRRGKHTGKASASATEEERVS
SCFCFSYIPDAKPQEADPYDIYQQFEIHQRRSSSRYYSATSVASDGVPPNYLKRKDWWVS
YSTSHDFGLRDDAKGINTKLRLDSELTSLGKSIEIGKWYVPFIFVMEGDVKDQMNKSTFY
SVTLQQRWEEVFFCENIGNEHFEVVVDVDVETESVKLEGQETNLREDSGDGVVWFSVLRD
EKDDKKIGLGSVVVERMKWEEERFGWLNEAGERSNIKRSERFEGGSSHWKSYRCYVLIES
FELTRMDGSLVLTYEFRHVDKLKSKWD

Other information
Ka divergence:-0.0984965KaKs divergence:0.0381415
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1140Length 2 (bp):1164Length divergence:0.01
MFE 1 (kcal):-317.81MFE 2 (kcal):-327.01MFE divergence0.014