Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13640-AT2G03890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphatidylinositol 3- and 4-kinase family protein
Function (paralog2):phosphoinositide 4-kinase gamma 7

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6715125479646
Log2 mRNA fold difference:0.72403499640374
Log2 TE fold difference:1.2113212430188
Sequences
Protein sequence

MAMAVFKAPLKGEFHGARKMEGKQYKHHLLQQQSTGRRRVFVQTDTGCVLGVELDRNDNV
HTVKKRLQIAFNFPTEESSLTFGDMVLKNDLSAVRNDSPLLLKRNLMHRSSSTPCLSPTG
NDLQRKDRSGPIEILSHSPCFLSLKQTANDIVKAMKMGVEPIPVNGGLGGAYYFRDEKGQ
SVAIVKPTDEEPFAPNNPKGFVGKALGQPGLKPSVRVGETGFREVAAYLLDYDHFANVPP
TALVKITHSVFNVNDGMDGNKSREKKKLVSSKIASFQKFVPHDFDASDHGTSSFPVASVH
RIGILDIRILNTDRHGGNLLVKKLDDGGVGRFGQVELIPIDHGLCLPETLEDPYFEWIHW
PQASIPFSEEELDYIQSLDPVKDCEMLRRELPMIREACLRVLVLCTVFLKEAAVFGLCLA
EIGEMMTREFRAGEEEPSELEMLCIEAKRLTTEQDVLSPKSDGEGETEFQFDIDYNELDS
VYGSETETDEFFAKNPFSNGRSSLGELKESIAEEEEDDEEEAKLTLSLSKLSTSMKNNLS
NTMGSGYLKPPKDNQTDKALVSHKSANVQLPLSVNFVKLADMKEVEWVVFLERFQELLYS
AFAERKTMTLRNTQRLGTSCKF

MSRNLDSPVQTQMAVAVFKTPLTGASKMEGKQHHKHQHLQRQSSGRRVFVQTETGCVLGM
ELDRSDNVHTVKRRLQIALNFPTEESSLTYGDMVLTNDLSAVRNDSPLLLKRNFMHRSSS
TPCLSPTGRDLQQKDRSGPIEILGHSDCFSIVKHMVKDIVKAMKMGVEPLPVHSGLGGAY
YFRNKRGESVAIVKPTDEEPFAPNNPKGFVGKALGQPGLKSSVRVGETGFREVAAYLLDY
GRFANVPPTALVKITHSVFNVNDGVKGNKPREKKLVSKIASFQKFVAHDFDASDHGTSSF
PVTSVHRIGILDIRIFNTDRHGGNLLVKKLDGVGMFGQVELIPIDHGLCLPETLEDPYFE
WIHWPQASLPFSDEEVDYIQSLDPVKDCDMLRRELPMIREACLRVLVLCTIFLKEASAYG
LCLAEIGEMMTREFRPGEEEPSELEVVCIEAKRSVTERDVFSPRSDVVGEAEFQFDLDCD
DLESVYSSKIQLTDDYFTKNPFSNGRSSLGKLEESIKEEEEDEEEEEDKTENTVPMIIMK
DSFFSSAAFHDKAPSLSKLSTSMKNTHLSDTTRKNPKPLTRGKSENTSSGHKSANEQLPV
SASFVKVADMKEDEWVLFLERFQELLGPAFAKRKTATLSKRQRLGTSCQF

www.000webhost.com

Other information
Ka divergence:-0.250722KaKs divergence:-0.228175
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1869Length 2 (bp):1953Length divergence:0.022
MFE 1 (kcal):-583.1MFE 2 (kcal):-605.62MFE divergence0.019