Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13730-AT2G03640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Function (paralog2):Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.87411963749102
Log2 mRNA fold difference:2.2466780842724
Log2 TE fold difference:-1.176797470817
Sequences
Protein sequence

MALESNAPVVDPNTIGNSFVEKYYNLLYKSPSQVHQFYLDDSVLGRPGSDGEMVSVKSLK
AINEQIMSFDYEISKIQILTADSQASYMNGVVTLVTGLLTVKEGQRMRFSQSFFLVPLNG
SYFVLNDVFRYVADEIVEPEANKKEVEEVIPQVVQPTEQVDEVAEPVTIPTQQPEAKQTT
ENTVKKPERAVANGHPKTQEDNVVNDKSNGVDAPKKSFAHIVQDLAQNGATFNAKASPAK
PKSKPVTKPSAARESKAPAPVSEHSSAATIDQQAEGYTIFVANLLMDATPEQLNETFKGF
GAITKDGIQVRSYRLKGNCFGFVTFASAEAVKLVLQAHKESAIRIGNRRVSIEEKRGNND
NGRPAMRNGGYRNDNGYRNDGYRPRGNGSNGGRGYGRNGSERRGESRNGEAHNGDGKVHQ
NGTVEASR

MTPESNAPSVDPQFVGNGFVQEYYNHLYDSTSEVHKFYLEDSMISRPGLDGEIVTIKSLK
GINDQIMSIDYKSSRIEILTADSQSTLKNGVVTLVTGLVIGNDGGRRKFSQSFFLVSRNG
SYFVLNDTFRYVSDEFVEPEATKEVEESQSTNAITAEPANESVEAVIVPTEAKTTVTKPA
SAIPNGHAKVPEEKVVNENSSLPKAAEAKLQEEVPKKSFALIVQSLAQSAGTLQVKASPV
KRKPVEKPVAAPERKAPSPIRKQASAESIKPQAQGSSIFVANLPMDATIEQLYETFKSFG
AIRKDGIQVRSYPEKKNCIGFVAFENGEAVKNVFQAHRESPIRIGNRRASIEEKRGKFLK
GIVVSKIVTLIKCKNKILILLFLDYAGGNNQNGNRVSTRNNSGYKNEDGFRRDGYKPRGS
GVNGGRGYGRRNSESNGDGKAYQNNGHGNTEAKN

Other information
Ka divergence:0.104733KaKs divergence:-0.149216
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1287Length 2 (bp):1365Length divergence:0.029
MFE 1 (kcal):-371.21MFE 2 (kcal):-391.4MFE divergence0.026