Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13860-AT2G03480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):QUASIMODO2 LIKE 1
Function (paralog2):QUASIMODO2 LIKE 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.68305007110035
Log2 mRNA fold difference:-0.34960090493719
Log2 TE fold difference:-0.37712393745222
Sequences
Protein sequence

MKVASVIGLRPRISGLLFLTLGVIALITILVPNSDSSSTTSTTRVPPSNIYSNYGRVKEQ
AAVDYLDLRFFSLGVNRLKEFPLCGKERDNYVPCYNVTESDRNCEFAREEERCLVRPPRD
YKIPLRWPVGRDIIWTGNVKITKDQFLSSGTMTKRLMLLEENQITFHSDDGLIFDGVKDY
AFQIAEMIGLGSDTEFPQAGIRTVLDIGCGFGSFGAHLVSLNVMPICIAEYETSGSQVQL
ALERGLPAMIGNFFSKQLPYPALSFDMVHCAQCGITWDIKDAMLLLEVDRVLKPGGYFVL
TSPTSKAQGNSPDTKKTSISTRVDELSKKICWSLSGQQDETFLWQKTADPNCYSSRSQAS
IPVCKDDDSVPYYHPLVPCISGTKSKRWIPIQNRSRASGTSLSELEIHGIKPEEFDEDIQ
VWRSALKNYWSLLTPLIFSDHPKRPGDEDPVPPFYMIRNAMDMNARYGNLNQALLNQGKS
VWVMNVVPVKARNTLPIILDRGFTGALHDWCEPFPTYPRTYDMLHANELLTHLSSERCSL
MDLFLEMDRILRPEGWVVLSDKLGVIEMARTLAARVRWEARVIDIQDGSDQRLLVCQKPL
LKK

MRGSWYKSVSSVFGLRPRIRGLLFFIVGVVALVTILAPLTSNSYDSSSSSTLVPNIYSNY
RRIKEQAAVDYLDLRSLSLGASLKEFPFCGKERESYVPCYNITGNLLAGLQEGEELDRHC
EFEREKERCVVRPPRDYKIPLRWPLGRDIIWSGNVKITKDQFLSSGTVTTRLMLLEENQI
TFHSEDGLVFDGVKDYARQIAEMIGLGSDTEFAQAGVRTVLDIGCGFGSFGAHLVSLKLM
PICIAEYEATGSQVQLALERGLPAMIGNFFSKQLPYPALSFDMVHCAQCGTTWDIKDAML
LLEVDRVLKPGGYFVLTSPTNKAQGNLPDTKKTSISTRVNELSKKICWSLTAQQDETFLW
QKTSDSSCYSSRSQASIPLCKDGDSVPYYHPLVPCISGTTSKRWISIQNRSAVAGTTSAG
LEIHGKSALKNYWSLLTPLIFSDHPKRPGDEDPLPPFNMIRNVMDMHARFGNLNAALLDE
GKSAWVMNVVPVNARNTLPIILDRGFAGVLHDWCEPFPTYPRTYDMLHANELLTHLSSER
CSLMDLFLEMDRILRPEGWVVLSDKVGVIEMARALAARVRWEARVIDLQDGSDQRLLVCQ
KPFIKK

Other information
Ka divergence:-0.135578KaKs divergence:-0.256143
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1812Length 2 (bp):1821Length divergence:0.002
MFE 1 (kcal):-518.72MFE 2 (kcal):-564.4MFE divergence0.042