Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13880-AT2G03470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ELM2 domain-containing protein
Function (paralog2):ELM2 domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.061876574937224
Log2 mRNA fold difference:0.98467531604951
Log2 TE fold difference:-0.86171011555072
Sequences
Protein sequence

MGFKRTFDAEDVQELNVKNGRQISYCNKLAKLDEGVPYRLSLEKPGVVGYDISDLYGYKC
EDNVDKGFETNAPFSWITTGLSEEDSQSGATIQSTISHESPESDIPWRPVCSGEEDGYWC
PISPRKTVPIGSDYQADIPECVKEEANDQSGQGVGYDEEQVTGKCVIPMPDCETEVCKIG
KGRKECICLDKGSIRCVQQHIMENREDLFATIGYDRCLDIGLCEMGEEVAARLTEDEEDL
FHEIVYSNPVSMDRDFWKHLKSAFPSRTMKEIVSYYFNVFILRRRAIQNRSKSLDVDSDD
DEWQVEYDNTFYGAETPSDDKAEKSLSRDEGEEVNANEDSYMSFENQSNAIYSRCPVRNR
EESNIGNYWRHCNDLVDQSYSFDPCDSILPDHCWTKNIDLLPTSNIIDEIFGQDHPWDDF
SRGK

MGLKRPYDAEEMQKCNAKHARQLSYKNHNQFDEAIPYHHASMEKKTNVLVEDLIGLCENP
TWTNDANHVDKGFETTGLCQEDSQSGVTTQSDLSHQSSGSDFTWKPVEDVYTCLMNQPPR
KQVLVGSNHQADIPEFVKEEILDQSEARTKEDLEGKLMRKCVIPMSDSDLCGTGQGRKEC
LCLDKGSIRCVRRHIIEARESLVETIGYERFMELGLCEMGEEVASLWTEEEEDLFHKVVY
SNPFSAGRDFWKQLKGTFPSRTMKELVSYYFNVFILRRRGIQNRFKALDVDSDDDEWQVE
YNIFNSTKSLDEEDNNGNRSSYEDNEEEEETSSNDDDEEEEEEDDSSSNDAHCVDTDKAS
RDGFGEEVNVEDDSCMSFELQDSNLIFSHNPIKNRECHRSGEDSYSFDDQRFTSDCWNKN
NDLLPTSNIIEEIFGQDDWGDKDDNNLKEK

www.000webhost.com

Other information
Ka divergence:-0.287765KaKs divergence:0.235281
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1275Length 2 (bp):1353Length divergence:0.03
MFE 1 (kcal):-370.22MFE 2 (kcal):-389.33MFE divergence0.025