Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13900-AT2G03450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Purple acid phosphatases superfamily protein
Function (paralog2):purple acid phosphatase 9

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.0693092866358
Log2 mRNA fold difference:-1.9458640945169
Log2 TE fold difference:-0.094017338896214
Sequences
Protein sequence

MIVNFSFFLLLFVSVFVSSADSKATISISPNALNRSGDSVVIQWSGVDSPSDLDWLGLYS
PPESPNDHFIGYKFLNESSTWKDGFGSISLPLTNLRSNYTFRIFRWSESEIDPKHKDHDQ
NPLPGTKHLLAESEQLTFGSGVGMPEQIHLSFTNMVNTMRVMFVAGDGEERFVRYGESKD
LLGNSAAARGMRYEREHMCDSPANSTIGWRDPGWIFDTVMKNLNDGVRYYYQVGSDSKGW
SEIHSYIARDVTAEETVAFMFGDMGCATPYTTFIRTQDESISTVKWILRDIEALGDKPAM
ISHIGDISYARGYSWVWDEFFAQVEPIASTVPYHVCIGNHEYDFSTQPWKPDWAASIYGN
DGGGECGVPYSLKFNMPGNSSESTGMKAPPTRNLYYSYDMGTVHFVYISTETNFLKGGSQ
YEFIKRDLESVDRKKTPFVVVQGHRPMYTTSNEVRDTMIRQKMVEHLEPLFVKNNVTLAL
WGHVHRYERFCPISNNTCGTQWQGNPVHLVIGMAGQDWQPIWQPRPNHPDLPIFPQPEQS
MYRTGEFGYTRLVANKEKLTVSFVGNHDGEVHDTVEMLASGVVISGSKESTKIPNLKTVP
ASATLMGKSESNALWYAKGAGLMVVGVLLGFIIGFFTRGKKSSSGNRWIPVKNEET

MIAAVYTLFFFFLLISSVYSKATISISPQTLNRSGDIVVIKWSGVESPSDLDWLGIYSPP
DSPHDHFIGYKFLSDSPTWQSGSGSISLPLTNLRSNYTFRIFHWTQSEINPKHQDHDHNP
LPGTRHLLTESNQLNFRFAVNRPEQIHLSYTDNINEMRVVFVTGDGEEREARYGEVKDKL
DNIAVARGVRYEIEHMCHAPANSTVGWRDPGWTFDAVMKNLKQGIRYYYQVGSDLKGWSE
IHSFVSRNEGSEETLAFMFGDMGCYTPYTTFIRGEEESLSTVKWILRDIEALGDDKPVIV
SHIGDISYARGYSWIWDEFFTQIEPIASKVPYHVCIGNHEYDWPNQPWKPDWAAYVYGKD
SGGECGVPYSVKFNMPGNSTEATGMVKGPQSRNLYYSYDMGSVHFVYISTETDFLKGGKQ
YSFLKSDLESVNRSKTPFVVVQGHRPMYTTSRKIRDAAIREKMIEHLEPLLVKNNVTVAL
WGHVHRYERFCAISNNTCGERWQGNPVHLVIGMAGKDSQPMWEPRANHEDVPIFPQPANS
MYRGGEFGYIRLVANKERLTLSYVGNHDGEVHDVVEILASGEVISGSDDGTKDSNFGSES
DFAVLWYIEGASVMVVGVIFGYFVGFLSRKKKESGVGSSNRSWIQVKNEET

Other information
Ka divergence:-0.0261877KaKs divergence:0.0527807
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1971Length 2 (bp):1956Length divergence:-0.004
MFE 1 (kcal):-626.41MFE 2 (kcal):-579.29MFE divergence-0.039