Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13930-AT2G03440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):nodulin-related protein 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.0293897712331
Log2 mRNA fold difference:-3.5144614461696
Log2 TE fold difference:0.51874783444788
Sequences
Protein sequence

MNFISDQVKKLSSSTPEEPDHNKPVEGTETATRPATNAELMASAKVVAEAAQAAARNESD
KLDKGKVAGASADILDAAEKYGKFDEKSSTGQYLDKAEKYLNDYESSHSTGAGGPPPPTS
QAEPASQPEPAAKKDDEESGGGLGGYAKMAQGFLK

MDFFTDQVKKKFSDKKPESSDPEPNHNKNKPGHTEPTTHKPGHGEPTTHKPVSNTDPTTH
RPATNAELMASAKIVAEAAQAAARHESDKLDKAKVAGATADILDAASRYGKLDEKSGVGQ
YLEKAEQYLHKYETSHSHSSTGGTGSHGNVGGHGGGAGAPAAKKEDEKSGGGHGFGDYAK
MAQGFMK

www.000webhost.com

Other information
Ka divergence:-0.793388KaKs divergence:0.999663
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):468Length 2 (bp):564Length divergence:0.093
MFE 1 (kcal):-160.2MFE 2 (kcal):-178.54MFE divergence0.054