Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G13960-AT2G03340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WRKY DNA-binding protein 4
Function (paralog2):WRKY DNA-binding protein 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.71986616690911
Log2 mRNA fold difference:0.47169459392861
Log2 TE fold difference:0.15975135994881
Sequences
Protein sequence

MSEKEEAPSTSKSTGAPSRPTLSLPPRPFSEMFFNGGVGFSPGPMTLVSNMFPDSDEFRS
FSQLLAGAMSSPATAAAAAAAATASDYQRLGEGTNSSSGDVDPRFKQNRPTGLMISQSQS
PSMFTVPPGLSPAMLLDSPSFLGLFSPVQGSYGMTHQQALAQVTAQAVQANANMQPQTEY
PPPSQVQSFSSGQAQIPTSAPLPAQRETSDVTIIEHRSQQPLNVDKPADDGYNWRKYGQK
QVKGSEFPRSYYKCTNPGCPVKKKVERSLDGQVTEIIYKGQHNHEPPQNTKRGNKDNTAN
INGSSINNNRGSSELGASQFQTNSSNKTKREQHEAVSQATTTEHLSEASDGEEVGNGETD
VREKDENEPDPKRRSTEVRISEPAPAASHRTVTEPRIIVQTTSEVDLLDDGYRWRKYGQK
VVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPAAKSSSHAAAAA
QLRPDNRPGGLANLNQQQQQQPVARLRLKEEQTT

MAEKEEKEPSKLKSSTGVSRPTISLPPRPFGEMFFSGGVGFSPGPMTLVSNLFSDPDEFK
SFSQLLAGAMASPAAAAVAAAAVVATAHHQTPVSSVGDGGGSGGDVDPRFKQSRPTGLMI
TQPPGMFTVPPGLSPATLLDSPSFFGLFSPLQGTFGMTHQQALAQVTAQAVQGNNVHMQQ
SQQSEYPSSTQQQQQQQQQASLTEIPSFSSAPRSQIRASVQETSQGQRETSEISVFEHRS
QPQNADKPADDGYNWRKYGQKQVKGSDFPRSYYKCTHPACPVKKKVERSLDGQVTEIIYK
GQHNHELPQKRGNNNGSCKSSDIANQFQTSNSSLNKSKRDQETSQVTTTEQMSEASDSEE
VGNAETSVGERHEDEPDPKRRNTEVRVSEPVASSHRTVTEPRIIVQTTSEVDLLDDGYRW
RKYGQKVVKGNPYPRSYYKCTTPDCGVRKHVERAATDPKAVVTTYEGKHNHDVPAARTSS
HQLRPNNQHNTSTVNFNHQQPVARLRLKEEQIT

www.000webhost.com

Other information
Ka divergence:0.0381657KaKs divergence:0.19224
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1545Length 2 (bp):1542Length divergence:-0.001
MFE 1 (kcal):-475.76MFE 2 (kcal):-456.66MFE divergence-0.02