Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14020-AT2G03280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-fucosyltransferase family protein
Function (paralog2):O-fucosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.0589758327335
Log2 mRNA fold difference:-1.9788046774347
Log2 TE fold difference:-0.17585804527289
Sequences
Protein sequence

MEVRSESNITQARSDKLPLPPAVPKPRVQVWFVRVCSSILVWTCLVQLFAAGELWHSRIF
TGLTNQISRFSAPVEPVPLPPPLPPPRNYTSNGILLVSCNGGLNQMRSAICDMVTVARLL
NLTLVVPELDKTSFWADPSGFEDIFDVRHFIDSLRDEVRILRRLPKRFSRKYGYQMFEMP
PVSWSDEKYYLKQVLPLFSKHKVVHFNRTDTRLANNGLPLSLQWLRCRVNFQGLKFTPQL
EALGSKLVRILQQRGPFVALHLRYEMDMLAFSGCTHGCTEEEAEELKKMRYTYPWWREKE
IVSEERRAQGLCPLTPEEVALVLKALGFEKNTQIYIAAGEIYGSEHRLSVLREAFPRIVK
KEMLLESAELQQFQNHSSQMAALDFMVSVASNTFIPTYDGNMAKVVEGHRRYLGYKKTIL
LDRKRLVELLDLHHNKTLTWDQFAVAVKEAHERRAGAPTHRRVISDKPKEEDYFYANPQE
CLCEGTNCHDLFGHRNLTH

MSVVVGDRSESTLMRSDYKAPPSQAIPKARLQVWFFRVCSCILVWTCLIQLFWHSQIFTG
LTNHISRFSLPVQSVPLPPPLPPRNYTSNGILLVSCNGGLNQMRAAICDMVTVARLLNLT
LVVPELDKKSFWADTRYMFVSHVNDPTRFVCSLKHSFVSSFYSDFEDIFDIKHFIDSLRD
EVRIIRRLPKRYSKKYGFKLFEMPPVSWSNDKYYLQQVLPRFSKRKVIHFVRSDTRLANN
GLSLDLQRLRCRVNFQGLRFTPRIEALGSKLVRILQQRGSFVALHLRYEMDMLAFSGCTH
GCTDEEAEELKKMRYAYPWWREKEIVSEERRVQGLCPLTPEEAVLVLKALGFQKDTQIYI
AAGEIFGGAKRLALLKESFPRIVKKEMLLDPTELQQFQNHSSQMAALDFIVSVASNTFIP
TYYGNMAKVVEGHRRYLGFKKTILLDRKRLVELLDLHNNKTLSWDQFAVAVKDAHQGRRM
GEPTHRKVISVRPKEEDYFYANPQECIS

www.000webhost.com

Other information
Ka divergence:0.388483KaKs divergence:-0.0436913
GC content 1 (%):45GC content 2 (%):40GC content divergence:-0.059
Length 1 (bp):1500Length 2 (bp):1527Length divergence:0.009
MFE 1 (kcal):-481.51MFE 2 (kcal):-426.76MFE divergence-0.06