Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14040-AT2G03260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):EXS (ERD1/XPR1/SYG1) family protein
Function (paralog2):EXS (ERD1/XPR1/SYG1) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.1597520283025
Log2 mRNA fold difference:-1.9935435918916
Log2 TE fold difference:-0.16464917446215
Sequences
Protein sequence

MKFGKEFSSQMVPEWQQAYMDYDFLKTLLKEIITFKRRTNNAPSHGGAKTGGGLNRKLTL
YRAFSGLVSTPRHKRSNSSHDVEEGVQLTGSMRSGPILVNTTASHGYETTFLMAAEEGGE
YELVFFRRLDDEFNKVDKFYRKKVEEVLKEAAMLNKQMDALIAFRVKVENPDGWRWEERT
VEMTRLASDIATSAAALSASTPAGAKSMKVRSQEHMEAIQEGGSSRAGLMEDDEEDEDEQ
NETSVVSTGAIDNETTTSRMRGARPSPIDVLGRVKINNTKETPRSTIKGVLKVSKQTDLK
FSRENLMKVEESLKRAFIEFYQKLRLLKSYSFLNVLAFSKILKKYDKITSRDATKPYMKV
VDSSYLGSSDEVMRLMERVEATFIKHFANANRAKAMNILRPKAKRERHRITFSTGFSAGC
VFSLIVALVAIIRTRNLLEMEGQKEYMNTMFPLYSLFGFIVLHIIVYAANIYYWRRYRVN
YSFIFGFKQGTELGYRQVLLVGFSIGVLALLCVLANLDMEADPKTKAYQARTEILPLILL
AAMFIVLVLPFNYFYRSSRFFFLTCLFHCLAAPLYKVTLPDFFLGDQLTSQVQAIRSIEF
YICYYGWGDFRHRKSTCKESDVYNTFFFIVAVIPYVSRLLQCLRRLFEEKNPEQGYNGLK
YFLTIVAVCLRTAYSIQKGQVAWRVLAAVFSFIAAIFCTYWDFVHDWGLLNRTSKNRWLR
DKLLVPQKKVYFIAMVLNVLLRFAWIQTVLDFNFSFMHRQTMVAIVASLEIIRRGIWNFF
RLENEHLNNVGKYRAFKSVPLPFNYDEDDDKDN

MKFGKELSSQMVQEWQQAYVNYDYLKTLLKEIIKLKEKTNPPPPPHHAVPGEGISRKMTL
YRAFSGLVQTPGKKRQSSRQSNYSSEIDIEEGKAPILVSKSTHGLETTFLMTAEEGGEYE
LVFFRRLDDEFNRVEKFYKEKVEEVMKDAIMLNKQMDALIAFRVKVENPVGWGWEERTVE
MTRLASDIATSTAAIAASTPARTRTMNPRAQAHMEAIQEGSFSRENEDEDHGSVRGATGD
VKTSSLNTMRGARPAPIEVLDHIKINNTKATPRSTIKGVLNSSSQNEIIFNRQNLNEVEE
KLKFAFVEFYQKLRLLKSYSFLNVLAFSKILKKYDKITSRNASKSYMKMVDNSYLGSSDE
LMKLIQRVESTFIKHFANGHRRKGMNILRPQMKREKHRVTFSTGFSAGCIFSLIVALVAI
IRTRKTMPEAEHNTYMNTMFPLYSLFGFIVLHITMYAIDIYYWKRYRVNYAFIFGCKQGT
ELGYRQVLFLGFTIGTFALLCVLGNLDMEVNPKTKNFKPLTELLPLFLLVALFVVLIMPF
HFLYRSTRFFFLTCLLHCLAAPLYKVTLPDFFLGDQLTSQVQALRSINFYICYYGWGDFK
KRQNTCEASEIYIYSLYIVASLPYLSRLLQCMRRMIEERSLDQGYNGVKYLLTVIAVSLR
TAYGYEVKNTKNPTSHLKVLAGSSSILAAVFCTYWDFVHDWGLLNKTSKNRWLRDKLLIP
QKKVYFIAMILNVVLRFAWLQTILNFEFEFLHKQTTLAVVASLEIMRRGMWNFFRVENEH
LNNVGKFRAFKSVPLPFNYDEDDEKDD

www.000webhost.com

Other information
Ka divergence:0.398129KaKs divergence:-0.228433
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):2442Length 2 (bp):2424Length divergence:-0.004
MFE 1 (kcal):-726.67MFE 2 (kcal):-681.21MFE divergence-0.032