Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14070-AT1G14080
Species:Arabidopsis
Duplication type:TD
Function (paralog1):fucosyltransferase 7
Function (paralog2):fucosyltransferase 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.10029122768377
Log2 mRNA fold difference:-0.64404052009513
Log2 TE fold difference:0.54489245603129
Sequences
Protein sequence

MLLLLSFSNIFKHQLLGATINVGSKDSVKPRDRLLGGLLTADFDEDSCLSRYQSSLYRKP
SPYRTSEYLISKLRNYEMLHKRCGPGTDAYKRATEKLGHDHENVGDSSDGECKYIVWVAV
YGLGNRILTLASVFLYALLTERIILVDQRKDISDLFCEPFPGTSWLLPLDFPLMGQIDSF
NREYSHCYGTMLKNHTINSTTIPSHLYLHLLHDYRDQDKMFFCQKDQSLVDKVPWLVVKS
NLYFIPSLWLNPSFQTELIKLFPQKDTVFYHLARYLFHPTNQVWGMVTRSYNAYLSRADE
ILGIQVRVFSRQTKYFQHVMDQIVACTQREKLLPEFAAQEEAQVTNTSNPSKLKAVLVTS
LNPEYSNNLKKMYWEHPTTTGDIVEVYQPSRERFQQTDKKLHDQKALAEMYLLSLTDKLV
TSALSTFGYVAQGLGGLKPWILYTPKKFKSPNPPCGRVISMEPCFLTPPVHGCEAKKGIN
TAKIVPFVRHCEDLRHYGLKLVDDTKNEL

MKILLTLVFSGLLIWSVVLVSFSNDFNNQLLVATSNVSRESETPRDRLIGGLLTADFDEG
SCLSRYQQSLLYRKASPYKPSEYLVSKLRSYEKLHKRCGPGTDAYKKATEILGHDDENYA
SKSVGECRYIVWVAVYGLGNRILTLASVFLYALLTERVVLVDQSKDISDLFCEPFPGTSW
LLPLEFPLMKQIDGYNKGYSRCYGTMLNNQAINSTLIPPHLYLHILHDSRDNDKMFFCQK
DQSLVDKVPWLIVKANVYFVPSLWLNPTFQTELMKLFPQKEAVFHHLARYLFHPTNQVWG
LITRSYNAYLSRADETLGIQIRVFSDRAGYFQHVMDQVVACTRRENLLPEPAAQEEPKVN
ISRSQKLKAVLVTSLYPEYSETLKNMYWERPSSTGEIIEVYQPSGERVQQTDKKLHDQKA
LAEMYLLSLTDKIVTSARSTFGYVAHSLGGLKPWLLYQPTGPTAPDPPCIQSTSMDPCHL
TPPSHGCEPEWGTNSGKVVPFVRHCEDRGNDGLKLFDEL

www.000webhost.com

Other information
Ka divergence:0.446574KaKs divergence:-0.0274595
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1530Length 2 (bp):1560Length divergence:0.01
MFE 1 (kcal):-409.42MFE 2 (kcal):-451.32MFE divergence0.049