Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14120-AT1G14130
Species:Arabidopsis
Duplication type:TD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.053856288528083
Log2 mRNA fold difference:-0.30171209612152
Log2 TE fold difference:0.26286510406914
Sequences
Protein sequence

MAEVNGVIPTIDLEEVNDQILNEKIREASERWGCFTVINHGVSLSLMAEMKKTVRDLHER
PYEMKLRNTDVLLGNGYKPLSEFNPFYESFGLFDMASPQAVNSFCDKLDASPDQREILLK
YAKATDDLARSLARRLAESYGVVEPNFLRGWPSQFRMNKYHFKPDSVGKLGVILHTDPGF
LTILQGDEDVGGLEAMDNSSGSFFPIHTLPNTLLVNLGDMATIWSNGRLCNVKHRVQCIE
AKMRITIASFLLGPVDRDLEAPDEFVDAEHPRLYKPISDGGLRKIRLSKHLHAGESLKFI
TINELSDVPKID

MGELNGVIIPTIDLEEVSDKILNQKIREASERWGCFRVINHGVSLSLMAEMKKTVIDLFQ
RPYEVKVRNTDVLLGSGYRAPNEINPYYEALGLYDMASPHAVNTFCDQLEASADQREIMV
KYAKAINGLATDLARKLAESYGLVETDFFKEWPSQFRINKYHFKPETVGKLGVQLHTDSG
FLTILQDDENVGGLEAMDNSSGTFFPIDPLPNTLAINLGDMATIWSNGRLCNVKHRVQCK
EATMRYSIASFLLGPMDTDLEPPSEFVDAEHPRLYKPISHEGVRNIRMTKKLHDGEALKL
ITHAGLDK

Other information
Ka divergence:-0.591759KaKs divergence:-0.999892
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):939Length 2 (bp):927Length divergence:-0.006
MFE 1 (kcal):-281.4MFE 2 (kcal):-271.95MFE divergence-0.017