Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14185-AT1G14190
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Glucose-methanol-choline (GMC) oxidoreductase family protein
Function (paralog2):Glucose-methanol-choline (GMC) oxidoreductase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9235018710847
Log2 mRNA fold difference:-1.4513430175999
Log2 TE fold difference:-0.38447553155972
Sequences
Protein sequence

MSHFVFLFIISMFINLSQGAQMPYMTTDPKEVSGKSFDYIVVGGGTAGCSLAATLSEKYS
VLVIERGGSPFGDPLVEDKKYYGYSLINTDEYSSVAQSFTSVDGIKNHRGRVLGGSSAIN
GGFYSRASDEFVKKAGWDKDLVQESYKWVESKVVFMPELTRWQSIVQFGFLEAGFYPYNG
YSLEHTQGTKIGGSIFDQCGKRHTSADLLGYGKPNCITVLLNATVKSIIFDANKTRAVGV
RFMESDGNSSKSYKVHVEQHRGEVILAAGALGSPQILLLSGIGPENHLNDFDIPVIVNLK
EVGKQMSDNPAISLLVDRFSQNLTVDPPQVVAITEGFKFILQSLVLPTNITTTRTAISAK
IAFPKSKGRLKLNNTNPRENPSVTFNYLENKADLDACQEMVLHLQHVARSKTVTFFLGTQ
AQDKLVAGDEELKKFCIKNVRTYYHYHGGCVVGSVVNEEYKVNGVKRLRVVDGSTFEESP
GTNPMATVLMLGRYQGIKILKEH

MPYMTTDAKEVSGKSFDYIVVGGGTAGCSLAATLSEKYSVLVIERGGSPFGDPLVEERKY
FGYSLLNTDEYSSVAQSFTSVDGIENYRGRVLGGSSAINGGFYSRASDEFVKKAGWDKGL
VQESYKWVESKVVFMPELTQWQSVVQFGFLEAGFYPYNGYSLEHTQGTKIGGSIYDQCGK
RHTSADLLGFGKPNCITVLLNTTVKSIIFDSSNKTRAVGVRFMESDGNSSKSYKVHVEQH
RGEVILAAGALGSPQILLLSGIGPENHLKDFDIPVIVNLKEVGRKMSDNPAISLLVDRFS
QNRTLEPPQVAAIAEGYKFILESEVLPTDITTTRISIAAKIAFPKSKGRLKLNSTNPREN
PSVKFNYLENKADLDACLEMVLHLQHVARSETVTFFLGTQAHDKLVAGDEELKSFCIKNV
RTYYHYHGGCVVGSVVDEEYKVNGVKRLRVVDGSTFEESPGTNPMATVLMLGRYQGIKIL
KEREEQEDTFLSPQGSPQPQP

Other information
Ka divergence:-0.177149KaKs divergence:-0.238554
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1512Length 2 (bp):1506Length divergence:-0.002
MFE 1 (kcal):-431.42MFE 2 (kcal):-459.46MFE divergence0.031