Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G14230-AT1G14240
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GDA1/CD39 nucleoside phosphatase family protein
Function (paralog2):GDA1/CD39 nucleoside phosphatase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.093177673073495
Log2 mRNA fold difference:-1.0438503749998
Log2 TE fold difference:0.62299857181488
Sequences
Protein sequence

MQRSNARSRSNINSDMVDPPEVQTSPGNHRSSPSTAAKPKSKRTKSIIFVIVACVTIALG
LLFIGYSILRSGRNRRVSLHYSVIIDGGSSGTRVHVFGYRIESGKPVFDFGEENYASLKL
SPGLSAYADNPEGVSESVTELVEFAKKRVHKGKLKKSDIRLMATAGMRLLELPVQEQILD
VTRRVLRSSGFDFRDEWASVISGSDEGVYAWVVANHALGSLGGEPLKTTGIVELGGASAQ
VTFVSTELVPSEFSRTLAYGNVSYNLYSHSFLDFGQDAAQEKLSESLYNSAANSTGEGIV
PDPCIPKGYILETNLQKDLPGFLADKGKFTATLQAAGNFSECRSAAFAMLQEEKGKCTYK
RCSIGSIFTPNLQGSFLATENFFHTSKFFGLGEKEWLSEMILAGKRFCGEEWSKLKVKYP
TFKDENLLRYCFSSAYIISMLHDSLGVALDDERIKYASKAGEEDIPLDWALGAFILNTAT
ATFDYSGKSRKILDLSNVAKYKI

MTPETDALKVQILPKHQSLPYTVTKAKSKSLILLVVVSVTITLGLLLYVFNSNSVISSGS
LLSRRCKLRYSVLIDAGSSGTRVHVFGYWFESGKPVFDFGEKHYANLKLTPGLSSYADNP
EGASVSVTKLVEFAKQRIPKRMFRRSDIRLMATAGMRLLEVPVQEQILEVTRRVLRSSGF
MFRDEWANVISGSDEGIYSWITANYALGSLGTDPLETTGIVELGGASAQVTFVSSEHVPP
EYSRTIAYGNISYTIYSHSFLDYGKDAALKKLLEKLQNSANSTVDGVVEDPCTPKGYIYD
TNSKNYSSGFLADESKLKGSLQAAGNFSKCRSATFALLKEGKENCLYEHCSIGSTFTPDL
QGSFLATASFYYTAKFFELEEKGWLSELIPAGKRYCGEEWSKLILEYPTTDEEYLRGYCF
SAAYTISMLHDSLGIALDDESITYASKAGEKHIPLDWALGAFILDVVTPNSDYNGKSRKY
LGF

Other information
Ka divergence:0.322185KaKs divergence:-0.407097
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1512Length 2 (bp):1452Length divergence:-0.02
MFE 1 (kcal):-460.66MFE 2 (kcal):-434.55MFE divergence-0.029